Homologs in group_2155

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16220 FBDBKF_16220 79.4 Morganella morganii S1 pyrE Orotate phosphoribosyltransferase
EHELCC_16255 EHELCC_16255 79.4 Morganella morganii S2 pyrE Orotate phosphoribosyltransferase
NLDBIP_17085 NLDBIP_17085 79.4 Morganella morganii S4 pyrE Orotate phosphoribosyltransferase
LHKJJB_17005 LHKJJB_17005 79.4 Morganella morganii S3 pyrE Orotate phosphoribosyltransferase
HKOGLL_16835 HKOGLL_16835 79.4 Morganella morganii S5 pyrE Orotate phosphoribosyltransferase
F4V73_RS17380 F4V73_RS17380 77.6 Morganella psychrotolerans pyrE orotate phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_2155

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2155

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F0W4 8.04e-160 442 100 0 214 3 pyrE Orotate phosphoribosyltransferase Proteus mirabilis (strain HI4320)
Q7MY25 2.32e-126 358 78 0 213 3 pyrE Orotate phosphoribosyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DIC6 2.29e-123 350 76 0 213 3 pyrE Orotate phosphoribosyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q83J15 6.71e-122 347 76 0 213 3 pyrE Orotate phosphoribosyltransferase Shigella flexneri
B7LVK4 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NEU6 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7E3 2.14e-121 345 76 0 213 1 pyrE Orotate phosphoribosyltransferase Escherichia coli (strain K12)
B1IYV8 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7E4 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBG7 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A6A4 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O9:H4 (strain HS)
B1X976 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli (strain K12 / DH10B)
C4ZXN4 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4C7 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O8 (strain IAI1)
B7N1U3 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O81 (strain ED1a)
B7L766 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli (strain 55989 / EAEC)
B7UM49 2.14e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7MQA9 2.17e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
C5B9D0 3.83e-121 345 76 0 213 3 pyrE Orotate phosphoribosyltransferase Edwardsiella ictaluri (strain 93-146)
B1LK79 3.83e-121 345 75 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7NQ04 4.18e-121 345 75 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MFK3 4.99e-121 345 75 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q31UY4 8.91e-121 344 76 0 213 3 pyrE Orotate phosphoribosyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TTV6 8.91e-121 344 76 0 213 3 pyrE Orotate phosphoribosyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YWE0 8.91e-121 344 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XD99 8.91e-121 344 76 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O157:H7
Q0SYG9 9.01e-121 344 75 0 213 3 pyrE Orotate phosphoribosyltransferase Shigella flexneri serotype 5b (strain 8401)
Q8Z2H5 1.24e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella typhi
P08870 1.41e-120 343 76 0 213 1 pyrE Orotate phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TZY3 1.41e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella schwarzengrund (strain CVM19633)
C0Q1X4 1.41e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella paratyphi C (strain RKS4594)
A9MVN7 1.41e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SXE3 1.41e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella newport (strain SL254)
B4T9Y5 1.41e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella heidelberg (strain SL476)
B5RG81 1.41e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5G6 1.41e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FM65 1.41e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella dublin (strain CT_02021853)
Q57IA0 1.41e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella choleraesuis (strain SC-B67)
B5BI16 1.84e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PC26 1.84e-120 343 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5EXE6 3.83e-120 342 76 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella agona (strain SL483)
Q329L4 4.47e-120 342 75 0 213 3 pyrE Orotate phosphoribosyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B6I3L9 5.32e-120 342 75 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli (strain SE11)
A7ZTJ3 5.32e-120 342 75 0 213 3 pyrE Orotate phosphoribosyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YW04 7.31e-120 342 75 0 213 3 pyrE Orotate phosphoribosyltransferase Shigella sonnei (strain Ss046)
A8GLE9 1.49e-119 341 76 0 213 3 pyrE Orotate phosphoribosyltransferase Serratia proteamaculans (strain 568)
A6TFN4 1.9e-119 340 75 0 213 3 pyrE Orotate phosphoribosyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTG0 1.57e-118 338 75 0 213 3 pyrE Orotate phosphoribosyltransferase Klebsiella pneumoniae (strain 342)
A9MKN3 3.95e-117 335 74 0 213 3 pyrE Orotate phosphoribosyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4W507 4.26e-117 335 74 0 213 3 pyrE Orotate phosphoribosyltransferase Enterobacter sp. (strain 638)
B2VF77 1.5e-116 333 72 0 213 3 pyrE Orotate phosphoribosyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JHW8 1.61e-116 333 73 0 213 3 pyrE Orotate phosphoribosyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6LVN7 4.65e-116 332 72 0 213 3 pyrE Orotate phosphoribosyltransferase Photobacterium profundum (strain SS9)
Q8E9L5 8.44e-116 331 72 0 214 3 pyrE Orotate phosphoribosyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B1JQX7 1.96e-115 330 72 0 214 3 pyrE Orotate phosphoribosyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66GE0 1.96e-115 330 72 0 214 3 pyrE Orotate phosphoribosyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSE1 1.96e-115 330 72 0 214 3 pyrE Orotate phosphoribosyltransferase Yersinia pestis (strain Pestoides F)
Q1CCZ8 1.96e-115 330 72 0 214 3 pyrE Orotate phosphoribosyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R670 1.96e-115 330 72 0 214 3 pyrE Orotate phosphoribosyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJP7 1.96e-115 330 72 0 214 3 pyrE Orotate phosphoribosyltransferase Yersinia pestis
B2JYM9 1.96e-115 330 72 0 214 3 pyrE Orotate phosphoribosyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C263 1.96e-115 330 72 0 214 3 pyrE Orotate phosphoribosyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCT0 1.96e-115 330 72 0 214 3 pyrE Orotate phosphoribosyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q87T92 5.18e-115 329 73 0 213 3 pyrE Orotate phosphoribosyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DDX5 6.96e-115 329 73 0 213 3 pyrE Orotate phosphoribosyltransferase Vibrio vulnificus (strain CMCP6)
Q7MPT2 8.03e-115 329 73 0 213 3 pyrE Orotate phosphoribosyltransferase Vibrio vulnificus (strain YJ016)
Q9KVD5 3.89e-114 327 72 0 213 1 pyrE Orotate phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B7VHJ8 4.34e-114 327 72 0 213 3 pyrE Orotate phosphoribosyltransferase Vibrio atlanticus (strain LGP32)
B5FFE3 1.39e-112 323 72 0 213 3 pyrE Orotate phosphoribosyltransferase Aliivibrio fischeri (strain MJ11)
A4SHC9 1.22e-110 318 69 1 217 3 pyrE Orotate phosphoribosyltransferase Aeromonas salmonicida (strain A449)
Q3IJI1 1.17e-109 316 71 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudoalteromonas translucida (strain TAC 125)
B4S200 2.78e-109 315 69 0 213 3 pyrE Orotate phosphoribosyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0BT67 2.96e-108 312 68 0 213 3 pyrE Orotate phosphoribosyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H0G3 2.96e-108 312 68 0 213 3 pyrE Orotate phosphoribosyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZ36 2.96e-108 312 68 0 213 3 pyrE Orotate phosphoribosyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q88BD7 3.52e-107 310 66 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B8F557 3.89e-107 309 67 0 213 3 pyrE Orotate phosphoribosyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
A6VSX4 1.3e-106 308 67 1 215 3 pyrE Orotate phosphoribosyltransferase Marinomonas sp. (strain MWYL1)
Q4ZZY3 8.08e-106 306 65 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q48AN2 1.51e-105 306 66 1 221 3 pyrE Orotate phosphoribosyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q48Q10 2.39e-105 305 65 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9CJW4 6.75e-104 301 63 0 214 3 pyrE Orotate phosphoribosyltransferase Pasteurella multocida (strain Pm70)
A6VLF2 7.04e-103 298 64 0 213 3 pyrE Orotate phosphoribosyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A4VGS1 1.67e-102 298 64 1 215 3 pyrE Orotate phosphoribosyltransferase Stutzerimonas stutzeri (strain A1501)
P43855 5.51e-102 296 63 0 213 1 pyrE Orotate phosphoribosyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UAL7 5.51e-102 296 63 0 213 3 pyrE Orotate phosphoribosyltransferase Haemophilus influenzae (strain PittEE)
A5UG90 5.75e-102 296 63 0 213 3 pyrE Orotate phosphoribosyltransferase Haemophilus influenzae (strain PittGG)
Q4QNR7 5.75e-102 296 63 0 213 3 pyrE Orotate phosphoribosyltransferase Haemophilus influenzae (strain 86-028NP)
Q65W02 3.96e-101 294 62 0 213 3 pyrE Orotate phosphoribosyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VKV3 1.3e-99 290 62 0 213 3 pyrE Orotate phosphoribosyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P50587 1.36e-97 285 65 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02E31 1.36e-97 285 65 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V5M2 1.57e-97 285 65 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas aeruginosa (strain LESB58)
C1DI51 1.77e-97 285 64 0 213 3 pyrE Orotate phosphoribosyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4K3R9 1.6e-96 283 64 1 214 3 pyrE Orotate phosphoribosyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A6VED8 2.99e-96 282 64 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas aeruginosa (strain PA7)
B1J4L6 4.01e-96 281 63 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas putida (strain W619)
Q1I2T8 4.01e-96 281 63 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas entomophila (strain L48)
C3K476 1.04e-95 280 63 1 214 3 pyrE Orotate phosphoribosyltransferase Pseudomonas fluorescens (strain SBW25)
Q3K4M3 1.38e-95 280 63 1 214 3 pyrE Orotate phosphoribosyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q88C92 2.98e-95 279 63 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KQ92 2.98e-95 279 63 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas putida (strain GB-1)
A5WB07 2.98e-95 279 63 0 213 3 pyrE Orotate phosphoribosyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B8GTF1 2.87e-92 272 62 0 213 3 pyrE Orotate phosphoribosyltransferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C4K3W9 9.84e-88 260 61 0 213 3 pyrE Orotate phosphoribosyltransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q1QSL0 1.23e-86 258 56 2 227 3 pyrE Orotate phosphoribosyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1TY28 5.73e-86 256 57 1 213 3 pyrE Orotate phosphoribosyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q2YCI8 2.58e-85 254 55 1 211 3 pyrE Orotate phosphoribosyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3J6V6 2.63e-85 254 56 1 215 3 pyrE Orotate phosphoribosyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q2S8N8 3.49e-85 254 57 0 214 3 pyrE Orotate phosphoribosyltransferase Hahella chejuensis (strain KCTC 2396)
Q21EF2 2.06e-83 249 59 1 213 3 pyrE Orotate phosphoribosyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3SM42 1.66e-82 247 53 1 213 3 pyrE Orotate phosphoribosyltransferase Thiobacillus denitrificans (strain ATCC 25259)
B2I1J9 4.75e-82 246 58 3 211 3 pyrE Orotate phosphoribosyltransferase Acinetobacter baumannii (strain ACICU)
Q7W3H5 5.14e-82 246 55 2 214 3 pyrE Orotate phosphoribosyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7VSN4 5.55e-82 246 56 2 214 3 pyrE Orotate phosphoribosyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B7ICE9 6.04e-82 246 58 3 211 3 pyrE Orotate phosphoribosyltransferase Acinetobacter baumannii (strain AB0057)
B7GV69 6.04e-82 246 58 3 211 3 pyrE Orotate phosphoribosyltransferase Acinetobacter baumannii (strain AB307-0294)
Q7WEU9 7.37e-82 246 55 2 214 3 pyrE Orotate phosphoribosyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A3M9Y5 8.76e-82 245 58 3 211 3 pyrE Orotate phosphoribosyltransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
C5BLH1 1.02e-81 245 57 1 212 3 pyrE Orotate phosphoribosyltransferase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q8VR31 3.72e-80 241 56 1 212 3 pyrE Orotate phosphoribosyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6F6Z6 1.75e-79 239 58 4 210 3 pyrE Orotate phosphoribosyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B3PG74 1.11e-78 237 57 0 213 3 pyrE Orotate phosphoribosyltransferase Cellvibrio japonicus (strain Ueda107)
B8D880 1.14e-78 237 51 1 211 3 pyrE Orotate phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57622 1.14e-78 237 51 1 211 3 pyrE Orotate phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8C3 1.14e-78 237 51 1 211 3 pyrE Orotate phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
C1D6F5 4.7e-78 236 52 1 214 3 pyrE Orotate phosphoribosyltransferase Laribacter hongkongensis (strain HLHK9)
A1AXP4 2.59e-77 234 53 1 213 3 pyrE Orotate phosphoribosyltransferase Ruthia magnifica subsp. Calyptogena magnifica
A5CVN5 8.53e-76 230 54 0 196 3 pyrE Orotate phosphoribosyltransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q7NQ92 1.38e-75 229 52 1 214 3 pyrE Orotate phosphoribosyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9M1F6 3.98e-75 228 51 1 213 3 pyrE Orotate phosphoribosyltransferase Neisseria meningitidis serogroup C (strain 053442)
A6SUD4 4.1e-75 228 52 4 221 3 pyrE Orotate phosphoribosyltransferase Janthinobacterium sp. (strain Marseille)
A1KS25 6.79e-75 228 51 1 213 3 pyrE Orotate phosphoribosyltransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P65915 6.79e-75 228 51 1 213 3 pyrE Orotate phosphoribosyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P65914 6.79e-75 228 51 1 213 3 pyrE Orotate phosphoribosyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q820K1 1.5e-74 227 51 1 212 3 pyrE Orotate phosphoribosyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1WZE3 1.98e-74 226 52 1 213 3 pyrE Orotate phosphoribosyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
A4T0F4 6.22e-74 226 51 3 216 3 pyrE Orotate phosphoribosyltransferase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A4G1L0 1.1e-73 225 52 3 221 3 pyrE Orotate phosphoribosyltransferase Herminiimonas arsenicoxydans
Q5FAK5 1.63e-73 224 50 1 213 3 pyrE Orotate phosphoribosyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RNV9 1.76e-73 224 50 1 213 3 pyrE Orotate phosphoribosyltransferase Neisseria gonorrhoeae (strain NCCP11945)
Q0KF45 2.23e-73 224 55 3 213 3 pyrE Orotate phosphoribosyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LS40 3.12e-73 224 53 3 215 3 pyrE Orotate phosphoribosyltransferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A9I0G7 2.46e-72 222 54 2 214 3 pyrE Orotate phosphoribosyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2KU70 3.9e-72 221 53 2 213 3 pyrE Orotate phosphoribosyltransferase Bordetella avium (strain 197N)
Q5ZW83 4.87e-68 210 56 3 212 3 pyrE Orotate phosphoribosyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IBA2 4.87e-68 210 56 3 212 3 pyrE Orotate phosphoribosyltransferase Legionella pneumophila (strain Corby)
Q5X5W4 4.87e-68 210 56 3 212 3 pyrE Orotate phosphoribosyltransferase Legionella pneumophila (strain Paris)
Q8Y342 7.6e-68 210 49 3 217 3 pyrE Orotate phosphoribosyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2UD27 3.46e-67 209 49 3 217 3 pyrE Orotate phosphoribosyltransferase Ralstonia pickettii (strain 12J)
Q5WX86 3.35e-66 206 54 3 212 3 pyrE Orotate phosphoribosyltransferase Legionella pneumophila (strain Lens)
J9VQB3 4.79e-66 206 50 3 211 3 URA5 Orotate phosphoribosyltransferase Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
P0CS95 5.06e-66 206 50 3 211 3 URA5 Orotate phosphoribosyltransferase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CQ41 5.06e-66 206 50 3 211 3 URA5 Orotate phosphoribosyltransferase Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
B1XSI4 1.05e-65 205 51 3 216 3 pyrE Orotate phosphoribosyltransferase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
P59575 3.79e-65 202 42 1 205 3 pyrE Orotate phosphoribosyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P41923 4.04e-65 203 50 5 220 3 URA5 Orotate phosphoribosyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
O13474 1e-64 202 48 4 220 3 URA5 Orotate phosphoribosyltransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
A1VIL5 2.35e-64 202 47 5 230 3 pyrE Orotate phosphoribosyltransferase Polaromonas naphthalenivorans (strain CJ2)
A2SBW1 4.26e-64 201 47 3 217 3 pyrE Orotate phosphoribosyltransferase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q2P898 5.45e-63 197 48 3 217 3 pyrE Orotate phosphoribosyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A5EY64 7.7e-63 197 49 4 218 3 pyrE Orotate phosphoribosyltransferase Dichelobacter nodosus (strain VCS1703A)
Q87F16 5.19e-62 195 47 3 215 3 pyrE Orotate phosphoribosyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U1J0 7.52e-62 195 46 3 215 3 pyrE Orotate phosphoribosyltransferase Xylella fastidiosa (strain M12)
B2I6N0 7.52e-62 195 46 3 215 3 pyrE Orotate phosphoribosyltransferase Xylella fastidiosa (strain M23)
Q9PGZ3 2.16e-61 194 46 3 215 3 pyrE Orotate phosphoribosyltransferase Xylella fastidiosa (strain 9a5c)
O94331 2.73e-61 193 48 3 212 3 ura5 Orotate phosphoribosyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B2FJX2 2.87e-61 193 46 3 217 3 pyrE Orotate phosphoribosyltransferase Stenotrophomonas maltophilia (strain K279a)
Q8P469 2.2e-60 191 49 3 217 3 pyrE Orotate phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RXL2 2.2e-60 191 49 3 217 3 pyrE Orotate phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UPQ3 2.2e-60 191 49 3 217 3 pyrE Orotate phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q8PFS5 4.98e-60 190 48 3 217 3 pyrE Orotate phosphoribosyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q3BNB6 1.67e-59 189 48 3 217 3 pyrE Orotate phosphoribosyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P13298 5.04e-59 188 45 4 220 1 URA5 Orotate phosphoribosyltransferase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A6LS60 6.16e-59 187 47 3 199 3 pyrE Orotate phosphoribosyltransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B4STF6 1.99e-58 186 44 3 217 3 pyrE Orotate phosphoribosyltransferase Stenotrophomonas maltophilia (strain R551-3)
A9KKR4 1.35e-57 184 43 5 223 3 pyrE Orotate phosphoribosyltransferase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B3DS55 8.93e-57 182 45 7 223 3 pyrE Orotate phosphoribosyltransferase Bifidobacterium longum (strain DJO10A)
Q8G661 9.85e-57 182 49 5 191 3 pyrE Orotate phosphoribosyltransferase Bifidobacterium longum (strain NCC 2705)
B7GRU8 1.42e-56 182 49 5 191 3 pyrE Orotate phosphoribosyltransferase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q97N11 3.24e-55 178 44 3 195 3 pyrE Orotate phosphoribosyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A1A1G3 1.52e-54 177 43 7 223 3 pyrE Orotate phosphoribosyltransferase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
B2UW87 1.97e-54 176 44 3 199 3 pyrE Orotate phosphoribosyltransferase Clostridium botulinum (strain Alaska E43 / Type E3)
O42767 2.33e-54 176 40 6 227 3 URA5 Orotate phosphoribosyltransferase Metarhizium anisopliae
B2TNF7 3.5e-54 176 44 3 199 3 pyrE Orotate phosphoribosyltransferase Clostridium botulinum (strain Eklund 17B / Type B)
P30402 7.35e-54 175 43 4 221 1 URA10 Orotate phosphoribosyltransferase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B8DUJ6 1.83e-53 174 44 4 198 3 pyrE Orotate phosphoribosyltransferase Bifidobacterium animalis subsp. lactis (strain AD011)
P21846 2.09e-51 169 42 6 227 3 ura5 Orotate phosphoribosyltransferase Hypocrea jecorina
P35788 1.23e-50 167 43 6 227 3 PYR1 Orotate phosphoribosyltransferase Colletotrichum graminicola
Q7RVF7 1.18e-49 164 43 4 204 3 ura-5 Orotate phosphoribosyltransferase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
C4ZF78 4.29e-49 162 43 5 201 3 pyrE Orotate phosphoribosyltransferase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
P08309 5.05e-47 157 39 4 225 3 URA5 Orotate phosphoribosyltransferase Podospora anserina
P18904 1.02e-46 157 42 4 201 3 URA5 Orotate phosphoribosyltransferase Sordaria macrospora
O93849 1.05e-40 141 39 7 230 3 URA5 Orotate phosphoribosyltransferase Coccidioides posadasii (strain C735)
Q1DNB0 1.05e-40 141 39 7 230 3 URA5 Orotate phosphoribosyltransferase Coccidioides immitis (strain RS)
P58861 2.13e-17 79 28 4 166 3 pyrE Orotate phosphoribosyltransferase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P0CL79 2.31e-16 77 26 5 185 3 pyrE Orotate phosphoribosyltransferase Pyrococcus abyssi (strain GE5 / Orsay)
P0CL78 9.75e-16 75 25 5 185 3 pyrE Orotate phosphoribosyltransferase Pyrococcus abyssi
Q9HNG2 1.28e-15 74 28 5 177 3 pyrE Orotate phosphoribosyltransferase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
O61790 1.64e-15 75 29 4 161 1 R12E2.11 Orotate phosphoribosyltransferase Caenorhabditis elegans
P11172 1.95e-15 77 25 4 185 1 UMPS Uridine 5'-monophosphate synthase Homo sapiens
Q5JHF4 2.21e-15 74 27 3 168 3 pyrE Orotate phosphoribosyltransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
O58855 3.21e-15 73 26 3 160 3 pyrE Orotate phosphoribosyltransferase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P13439 3.49e-15 77 26 5 188 1 Umps Uridine 5'-monophosphate synthase Mus musculus
Q5R514 5.95e-15 76 25 4 185 2 UMPS Uridine 5'-monophosphate synthase Pongo abelii
A1RRV2 2.34e-14 71 28 6 198 3 pyrE Orotate phosphoribosyltransferase Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
P31754 2.9e-14 74 24 4 185 2 UMPS Uridine 5'-monophosphate synthase Bos taurus
Q42942 5.06e-14 73 28 6 187 2 PYR5-6 Uridine 5'-monophosphate synthase (Fragment) Nicotiana tabacum
A4WLH7 6.38e-14 70 29 6 187 3 pyrE Orotate phosphoribosyltransferase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
Q9UX09 8.98e-14 70 29 6 196 3 pyrE Orotate phosphoribosyltransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
D4GZW2 9.04e-14 69 29 5 184 3 pyrE2 Orotate phosphoribosyltransferase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A3CU84 1.08e-13 69 32 5 155 3 pyrE Orotate phosphoribosyltransferase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q2NFI3 1.23e-13 69 27 6 193 3 pyrE Orotate phosphoribosyltransferase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q42586 3.18e-13 71 30 6 180 2 PYRE-F Uridine 5'-monophosphate synthase Arabidopsis thaliana
P09556 9.5e-13 69 28 8 200 1 pyr56 Uridine 5'-monophosphate synthase Dictyostelium discoideum
Q8Q0J4 6.6e-12 65 27 5 156 3 pyrE Orotate phosphoribosyltransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
C5A1Y3 9.47e-12 64 27 4 168 3 pyrE Orotate phosphoribosyltransferase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
G5EDZ2 1.4e-11 66 25 5 192 1 umps-1 Uridine 5'-monophosphate synthase Caenorhabditis elegans
Q58509 1.5e-11 63 30 5 150 3 pyrE Orotate phosphoribosyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q970X1 1.52e-11 64 25 5 198 3 pyrE Orotate phosphoribosyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
A3MX27 2.27e-11 63 27 5 178 3 pyrE Orotate phosphoribosyltransferase Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q8ZTG3 3.71e-11 63 25 5 178 3 pyrE Orotate phosphoribosyltransferase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q8RZA1 1.51e-10 63 26 5 190 2 UMPS2 Uridine 5'-monophosphate synthase Oryza sativa subsp. japonica
O27888 1.54e-10 61 29 6 170 3 pyrE Orotate phosphoribosyltransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9LDN2 1.96e-10 63 27 4 190 2 UMPS1 Uridine 5'-monophosphate synthase Oryza sativa subsp. japonica
Q3IT15 2.6e-10 60 29 6 175 3 pyrE Orotate phosphoribosyltransferase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q18FD1 4.52e-10 60 27 7 176 3 pyrE Orotate phosphoribosyltransferase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
B3QC92 2.64e-09 57 34 7 147 3 pyrE Orotate phosphoribosyltransferase Rhodopseudomonas palustris (strain TIE-1)
Q6N0N8 2.73e-09 57 34 7 147 3 pyrE Orotate phosphoribosyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
O28533 3.78e-09 57 29 7 171 3 pyrE Orotate phosphoribosyltransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P58859 7.27e-09 56 23 7 191 3 pyrE Orotate phosphoribosyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O08359 8.49e-09 56 24 5 183 3 pyrE Orotate phosphoribosyltransferase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
A2BJ25 9.39e-09 56 26 6 190 3 pyrE Orotate phosphoribosyltransferase Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
A2SQ87 1.13e-08 55 25 3 151 3 pyrE Orotate phosphoribosyltransferase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q13CJ6 1.16e-08 56 33 7 147 3 pyrE Orotate phosphoribosyltransferase Rhodopseudomonas palustris (strain BisB5)
Q2J1V2 1.99e-08 55 33 7 147 3 pyrE Orotate phosphoribosyltransferase Rhodopseudomonas palustris (strain HaA2)
Q6LX60 3.16e-08 55 26 5 168 3 pyrE Orotate phosphoribosyltransferase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A3DM49 3.81e-08 55 27 6 168 3 pyrE Orotate phosphoribosyltransferase Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
Q25566 3.91e-08 56 25 5 170 3 UMP Uridine 5'-monophosphate synthase Naegleria gruberi
Q3B095 4.04e-08 54 29 7 173 3 pyrE Orotate phosphoribosyltransferase Synechococcus sp. (strain CC9902)
Q89BL4 4.64e-08 54 32 7 147 3 pyrE Orotate phosphoribosyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q0W6Q2 4.75e-08 54 27 8 188 3 pyrE Orotate phosphoribosyltransferase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Q2FPQ2 6.91e-08 53 28 3 149 3 pyrE Orotate phosphoribosyltransferase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q9HM15 7.01e-08 53 25 5 144 3 pyrE Orotate phosphoribosyltransferase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
A0RY85 9.2e-08 53 27 4 160 3 pyrE Orotate phosphoribosyltransferase Cenarchaeum symbiosum (strain A)
Q6L2K9 9.51e-08 53 25 5 171 3 pyrE Orotate phosphoribosyltransferase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q55574 1.11e-07 53 29 5 160 3 pyrE Orotate phosphoribosyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P58860 1.16e-07 53 31 3 131 3 pyrE Orotate phosphoribosyltransferase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q9RX68 1.3e-07 53 29 4 144 3 pyrE Orotate phosphoribosyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q97CT9 1.36e-07 52 24 5 144 3 pyrE Orotate phosphoribosyltransferase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
A9GUD3 1.96e-07 52 29 9 196 3 pyrE Orotate phosphoribosyltransferase Sorangium cellulosum (strain So ce56)
A2C0A9 3.4e-07 52 26 5 156 3 pyrE Orotate phosphoribosyltransferase Prochlorococcus marinus (strain NATL1A)
Q3AN25 4.54e-07 51 27 6 159 3 pyrE Orotate phosphoribosyltransferase Synechococcus sp. (strain CC9605)
Q92AH7 4.58e-07 52 30 5 133 3 pyrE Orotate phosphoribosyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8YM41 4.9e-07 52 26 6 162 3 pyrE Orotate phosphoribosyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q7UYX5 5.04e-07 51 32 5 152 3 pyrE Orotate phosphoribosyltransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A5EST0 6.59e-07 51 30 6 147 3 pyrE Orotate phosphoribosyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q20WV6 7.67e-07 51 31 6 147 3 pyrE Orotate phosphoribosyltransferase Rhodopseudomonas palustris (strain BisB18)
Q01637 8.47e-07 52 23 6 217 2 r-l Uridine 5'-monophosphate synthase Drosophila melanogaster
A5ULL0 1.07e-06 50 34 4 118 3 Msm_0883 PyrE-like protein Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
B7H6L8 1.28e-06 50 28 7 167 3 pyrE Orotate phosphoribosyltransferase Bacillus cereus (strain B4264)
B7IUP2 1.34e-06 50 29 5 134 3 pyrE Orotate phosphoribosyltransferase Bacillus cereus (strain G9842)
Q6HET2 1.4e-06 50 29 5 134 3 pyrE Orotate phosphoribosyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q732I7 1.42e-06 50 29 5 134 3 pyrE Orotate phosphoribosyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JJW9 1.42e-06 50 29 5 134 3 pyrE Orotate phosphoribosyltransferase Bacillus cereus (strain AH820)
Q81WF6 1.44e-06 50 29 5 134 1 pyrE Orotate phosphoribosyltransferase Bacillus anthracis
C3L744 1.44e-06 50 29 5 134 3 pyrE Orotate phosphoribosyltransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P652 1.44e-06 50 29 5 134 3 pyrE Orotate phosphoribosyltransferase Bacillus anthracis (strain A0248)
P0CB78 1.46e-06 50 28 3 131 1 pyrE Orotate phosphoribosyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DQL5 1.51e-06 50 28 3 131 3 pyrE Orotate phosphoribosyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04LJ2 1.51e-06 50 28 3 131 3 pyrE Orotate phosphoribosyltransferase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q819S7 2.13e-06 50 28 5 134 3 pyrE Orotate phosphoribosyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P65918 2.44e-06 50 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P65917 2.44e-06 50 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus agalactiae serotype III (strain NEM316)
Q3K146 2.68e-06 49 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3AC07 2.89e-06 49 26 6 198 3 pyrE Orotate phosphoribosyltransferase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A7GRK7 4.52e-06 49 28 6 150 3 pyrE Orotate phosphoribosyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A4YL97 5.8e-06 48 30 6 145 3 pyrE Orotate phosphoribosyltransferase Bradyrhizobium sp. (strain ORS 278)
A1SPW6 7.05e-06 48 29 5 149 3 pyrE Orotate phosphoribosyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q8DTV2 1.09e-05 48 26 3 131 1 pyrE Orotate phosphoribosyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9A076 1.29e-05 47 29 6 134 1 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M1
B5E302 1.38e-05 47 27 3 131 3 pyrE Orotate phosphoribosyltransferase Streptococcus pneumoniae serotype 19F (strain G54)
A7IAZ7 1.48e-05 47 29 4 123 3 Mboo_2394 PyrE-like protein Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Q8Y668 1.57e-05 47 23 7 198 3 pyrE Orotate phosphoribosyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q1JHA9 1.66e-05 47 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q71YI5 1.69e-05 47 28 4 132 3 pyrE Orotate phosphoribosyltransferase Listeria monocytogenes serotype 4b (strain F2365)
Q8PVD0 1.75e-05 47 30 2 127 3 MM_2035 PyrE-like protein Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P0DD69 1.76e-05 47 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q1J728 1.76e-05 47 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M4 (strain MGAS10750)
P65920 1.76e-05 47 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCK7 1.76e-05 47 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD68 1.76e-05 47 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P25972 1.77e-05 47 28 6 134 1 pyrE Orotate phosphoribosyltransferase Bacillus subtilis (strain 168)
Q5M4H9 1.84e-05 47 25 3 131 3 pyrE Orotate phosphoribosyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZW8 1.84e-05 47 25 3 131 3 pyrE Orotate phosphoribosyltransferase Streptococcus thermophilus (strain CNRZ 1066)
Q03KS5 1.94e-05 47 25 3 131 3 pyrE Orotate phosphoribosyltransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q1JM64 2.07e-05 47 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC80 2.07e-05 47 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M12 (strain MGAS2096)
A2RF04 2.09e-05 47 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M5 (strain Manfredo)
A7HX43 2.91e-05 46 31 5 143 3 pyrE Orotate phosphoribosyltransferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q8NKQ2 3.06e-05 46 26 3 126 3 pyrE1 PyrE-like protein Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P0A400 3.17e-05 47 27 5 163 3 purR Pur operon repressor Lactococcus lactis subsp. cremoris (strain MG1363)
P0A3Z9 3.17e-05 47 27 5 163 3 purR Pur operon repressor Lactococcus lactis subsp. lactis (strain IL1403)
A9VTC2 3.78e-05 46 28 5 134 3 pyrE Orotate phosphoribosyltransferase Bacillus mycoides (strain KBAB4)
Q8DHW5 4.05e-05 46 28 5 147 3 pyrE Orotate phosphoribosyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P46534 5.07e-05 46 27 2 129 2 pyrE Orotate phosphoribosyltransferase Bacillus caldolyticus
Q04R73 5.46e-05 45 28 5 151 3 pyrE Orotate phosphoribosyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q48U09 5.49e-05 45 29 6 134 3 pyrE Orotate phosphoribosyltransferase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q053K4 7.29e-05 45 28 5 151 3 pyrE Orotate phosphoribosyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q7V4S7 8.87e-05 45 24 4 170 3 pyrE Orotate phosphoribosyltransferase Prochlorococcus marinus (strain MIT 9313)
A2CCL7 8.96e-05 45 24 4 170 3 pyrE Orotate phosphoribosyltransferase Prochlorococcus marinus (strain MIT 9303)
Q8NM11 0.000115 44 28 4 138 1 pyrE Orotate phosphoribosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QHG9 0.000119 44 28 4 138 3 pyrE Orotate phosphoribosyltransferase Corynebacterium glutamicum (strain R)
Q9Y9D8 0.000187 44 29 6 178 1 pyrE Orotate phosphoribosyltransferase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q03NE4 0.000254 43 24 6 150 3 pyrE Orotate phosphoribosyltransferase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q11RP3 0.000255 43 27 5 134 3 pyrE Orotate phosphoribosyltransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A2BUQ6 0.000271 43 24 7 181 3 pyrE Orotate phosphoribosyltransferase Prochlorococcus marinus (strain MIT 9515)
O67742 0.000346 43 25 10 195 3 pyrE Orotate phosphoribosyltransferase Aquifex aeolicus (strain VF5)
P58862 0.000482 43 29 2 127 3 MA_0919 PyrE-like protein 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A8AXM7 0.000494 43 25 3 129 3 pyrE Orotate phosphoribosyltransferase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A3CN88 0.000518 43 25 3 129 3 pyrE Orotate phosphoribosyltransferase Streptococcus sanguinis (strain SK36)
Q8EUY4 0.000523 43 23 4 171 3 pyrE Orotate phosphoribosyltransferase Malacoplasma penetrans (strain HF-2)
A8FD21 0.000592 43 25 3 130 3 pyrE Orotate phosphoribosyltransferase Bacillus pumilus (strain SAFR-032)
Q8YSY4 0.000592 43 28 4 157 3 pyrFE Bifunctional enzyme PyrF/PyrE Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q5SHI8 0.000609 42 27 5 154 3 pyrE Orotate phosphoribosyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q6GHN0 0.000613 42 30 3 98 3 pyrE Orotate phosphoribosyltransferase Staphylococcus aureus (strain MRSA252)
P99144 0.000613 42 30 3 98 1 pyrE Orotate phosphoribosyltransferase Staphylococcus aureus (strain N315)
P65916 0.000613 42 30 3 98 3 pyrE Orotate phosphoribosyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q98AN7 0.000715 42 28 6 149 3 pyrE1 Orotate phosphoribosyltransferase 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P61499 0.000796 42 27 4 154 3 pyrE Orotate phosphoribosyltransferase Thermus thermophilus
P61498 0.000796 42 27 4 154 1 pyrE Orotate phosphoribosyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q465U8 0.000885 42 29 2 112 3 Mbar_A3471 PyrE-like protein 2 Methanosarcina barkeri (strain Fusaro / DSM 804)
B0SL24 0.001 42 24 4 145 3 pyrE Orotate phosphoribosyltransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SCV6 0.001 42 24 4 145 3 pyrE Orotate phosphoribosyltransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A2RLC0 0.001 42 28 4 97 3 pyrE Orotate phosphoribosyltransferase Lactococcus lactis subsp. cremoris (strain MG1363)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15585
Feature type CDS
Gene pyrE
Product orotate phosphoribosyltransferase
Location 3465693 - 3466337 (strand: 1)
Length 645 (nucleotides) / 214 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2155
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00156 Phosphoribosyl transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0461 Nucleotide transport and metabolism (F) F Orotate phosphoribosyltransferase

Kegg Ortholog Annotation(s)

Protein Sequence

MKAYQRHFIELALAKNVLKFGEFTLKSGRVSPYFFNAGLFNTGRDLALLGQFYAQTLIDNHVPCDVLFGPAYKGIPIATTTAVALVEHHDMDVPYCFNRKEAKDHGEGGTLVGSPLTGNVVIVDDVITAGTAIRESMEIIKQHDATLSGVLLSLDRQEKGRGSLSAIQELERDYQCQVYSIITLDDLISYLTESETLSAHLPAVKAYRERYGIN

Flanking regions ( +/- flanking 50bp)

TTTTTTTATGTCTAAAATCTGTCATTAAGCAATCTTAATAGGAGAAAAAAATGAAAGCCTACCAGCGCCACTTTATCGAACTTGCATTAGCAAAAAATGTATTAAAATTTGGTGAGTTTACGCTGAAATCAGGTCGTGTTAGTCCTTATTTTTTTAATGCAGGTTTATTTAATACTGGGCGTGACTTGGCTTTATTGGGACAGTTTTATGCACAAACATTAATAGATAATCATGTGCCTTGTGATGTGCTGTTTGGACCGGCTTATAAAGGTATTCCCATCGCGACAACGACCGCAGTGGCCTTAGTTGAACATCATGATATGGATGTTCCTTACTGCTTTAATCGTAAAGAAGCTAAAGATCATGGTGAAGGAGGGACATTAGTCGGCAGTCCATTAACAGGGAATGTGGTGATTGTTGATGATGTTATTACCGCTGGAACGGCTATTCGTGAATCGATGGAAATAATCAAACAACATGATGCGACGCTGTCAGGGGTATTGCTTAGTTTAGATAGACAAGAAAAAGGGCGTGGTTCGCTTTCTGCAATACAAGAATTAGAGCGCGATTATCAATGCCAAGTTTATTCAATTATTACTTTGGATGATTTAATTAGCTACTTAACTGAAAGTGAGACATTATCGGCACATTTGCCAGCAGTAAAAGCCTATCGTGAACGTTATGGCATTAATTAAAAAAGCAAAAATACAATAAAATCGCTCAATAGCTGTAAAAAAAAGCCCTC