Homologs in group_72

Help

12 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08060 FBDBKF_08060 75.9 Morganella morganii S1 fdnG formate dehydrogenase-N subunit alpha
FBDBKF_16120 FBDBKF_16120 88.0 Morganella morganii S1 fdnG formate dehydrogenase-N subunit alpha
EHELCC_13890 EHELCC_13890 75.9 Morganella morganii S2 fdnG formate dehydrogenase-N subunit alpha
EHELCC_16155 EHELCC_16155 88.0 Morganella morganii S2 fdnG formate dehydrogenase-N subunit alpha
NLDBIP_14335 NLDBIP_14335 75.9 Morganella morganii S4 fdnG formate dehydrogenase-N subunit alpha
NLDBIP_17185 NLDBIP_17185 88.0 Morganella morganii S4 fdnG formate dehydrogenase-N subunit alpha
LHKJJB_08515 LHKJJB_08515 75.9 Morganella morganii S3 fdnG formate dehydrogenase-N subunit alpha
LHKJJB_17105 LHKJJB_17105 88.0 Morganella morganii S3 fdnG formate dehydrogenase-N subunit alpha
HKOGLL_08065 HKOGLL_08065 75.9 Morganella morganii S5 fdnG formate dehydrogenase-N subunit alpha
HKOGLL_16735 HKOGLL_16735 88.0 Morganella morganii S5 fdnG formate dehydrogenase-N subunit alpha
F4V73_RS12935 F4V73_RS12935 76.7 Morganella psychrotolerans fdnG formate dehydrogenase-N subunit alpha
F4V73_RS17495 F4V73_RS17495 88.0 Morganella psychrotolerans fdnG formate dehydrogenase-N subunit alpha

Distribution of the homologs in the orthogroup group_72

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_72

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P32176 0.0 1838 84 1 1016 1 fdoG Formate dehydrogenase-O major subunit Escherichia coli (strain K12)
P24183 0.0 1709 77 0 1015 1 fdnG Formate dehydrogenase, nitrate-inducible, major subunit Escherichia coli (strain K12)
P46448 0.0 1385 63 3 1026 3 fdxG Formate dehydrogenase major subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q934F5 0.0 826 42 19 1037 1 fdhA Formate dehydrogenase subunit alpha Megalodesulfovibrio gigas
Q727P3 0.0 813 43 20 1030 1 fdnG-3 Formate dehydrogenase 2 subunit alpha (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P06131 5.02e-69 247 29 16 615 1 fdhA Formate dehydrogenase subunit alpha Methanobacterium formicicum
P06131 4.24e-07 57 32 6 170 1 fdhA Formate dehydrogenase subunit alpha Methanobacterium formicicum
P61159 3.85e-62 227 28 15 612 3 fdhA Formate dehydrogenase subunit alpha Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P61159 5.43e-07 57 28 5 164 3 fdhA Formate dehydrogenase subunit alpha Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P07658 4.04e-43 172 25 18 625 1 fdhF Formate dehydrogenase H Escherichia coli (strain K12)
Q5HDP9 4.44e-41 167 24 18 646 3 SACOL2301 Putative formate dehydrogenase SACOL2301 Staphylococcus aureus (strain COL)
Q2FVV9 4.44e-41 167 24 18 646 3 SAOUHSC_02582 Putative formate dehydrogenase SAOUHSC_02582 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEI5 4.44e-41 167 24 18 646 3 SAUSA300_2258 Putative formate dehydrogenase SAUSA300_2258 Staphylococcus aureus (strain USA300)
Q7A057 5.82e-41 167 24 17 645 3 MW2229 Putative formate dehydrogenase MW2229 Staphylococcus aureus (strain MW2)
Q6G711 5.82e-41 167 24 17 645 3 SAS2201 Putative formate dehydrogenase SAS2201 Staphylococcus aureus (strain MSSA476)
Q99RW4 5.82e-41 167 24 17 645 1 SA2102 Putative formate dehydrogenase SA2102 Staphylococcus aureus (strain N315)
Q931G2 1.73e-40 166 24 17 645 3 SAV2309 Putative formate dehydrogenase SAV2309 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q795Y4 2.58e-40 165 25 17 621 3 yrhE Putative formate dehydrogenase YrhE Bacillus subtilis (strain 168)
Q795Y4 2.08e-05 52 29 5 146 3 yrhE Putative formate dehydrogenase YrhE Bacillus subtilis (strain 168)
Q6GEC4 3.77e-40 164 24 18 646 3 SAR2393 Putative formate dehydrogenase SAR2393 Staphylococcus aureus (strain MRSA252)
Q49ZN0 4.04e-40 164 25 22 643 3 SSP0601 Putative formate dehydrogenase SSP0601 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2YYT1 2.29e-39 162 24 17 645 3 SAB2186c Putative formate dehydrogenase SAB2186c Staphylococcus aureus (strain bovine RF122 / ET3-1)
P73448 3.35e-39 160 24 13 621 3 narB Nitrate reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P73448 9.82e-07 56 28 4 133 3 narB Nitrate reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4L8G8 3.38e-39 161 24 15 623 3 SH0748 Putative formate dehydrogenase SH0748 Staphylococcus haemolyticus (strain JCSC1435)
O34720 4.22e-39 161 23 15 635 3 yjgC Probable oxidoreductase YjgC Bacillus subtilis (strain 168)
O34720 7.21e-05 50 30 4 131 3 yjgC Probable oxidoreductase YjgC Bacillus subtilis (strain 168)
Q67QZ1 1.55e-35 149 24 22 666 3 napA Nitrate reductase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q67QZ1 0.000179 49 31 3 130 3 napA Nitrate reductase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
O33732 3.73e-35 148 23 16 605 3 Sfri_1505 Nitrate reductase Shewanella frigidimarina (strain NCIMB 400)
P81186 6.73e-31 134 23 18 652 1 napA Periplasmic nitrate reductase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q47A87 6.91e-29 128 23 21 661 3 napA Periplasmic nitrate reductase Dechloromonas aromatica (strain RCB)
P39458 2.76e-28 125 28 9 280 1 narB Nitrate reductase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P39458 3.14e-05 51 29 6 177 1 narB Nitrate reductase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A9I7M5 4.41e-27 122 24 14 506 3 napA Periplasmic nitrate reductase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
P42434 9.19e-27 120 21 19 613 2 nasC Assimilatory nitrate reductase catalytic subunit Bacillus subtilis (strain 168)
A1SWQ0 1.01e-26 121 24 17 506 3 napA Periplasmic nitrate reductase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
P39185 1.17e-26 121 22 21 668 1 napA Periplasmic nitrate reductase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
D3RNN8 2.7e-26 120 24 12 448 1 soeA Sulfite dehydrogenase subunit A Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Q2W3T1 3.43e-26 119 23 22 618 3 napA Periplasmic nitrate reductase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q46RX3 1.54e-25 117 23 14 491 3 napA Periplasmic nitrate reductase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A5UAE1 2.68e-25 116 24 21 611 3 napA Periplasmic nitrate reductase Haemophilus influenzae (strain PittEE)
B1Y6A6 2.87e-25 116 25 16 492 3 napA Periplasmic nitrate reductase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q93HX3 3.32e-25 116 22 19 602 3 napA Periplasmic nitrate reductase Paramagnetospirillum magnetotacticum
Q8VL02 5.21e-25 115 25 15 440 3 napA Periplasmic nitrate reductase Aggregatibacter actinomycetemcomitans
A5ED21 5.6e-25 115 22 37 971 3 napA Periplasmic nitrate reductase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B3R8B4 6.07e-25 115 22 13 490 3 napA Periplasmic nitrate reductase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q4QNJ6 1.85e-24 114 24 23 661 3 napA Periplasmic nitrate reductase Haemophilus influenzae (strain 86-028NP)
A0KIM1 2.01e-24 114 22 20 598 3 napA Periplasmic nitrate reductase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B9KCQ2 2.58e-24 114 22 18 516 3 napA Periplasmic nitrate reductase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B0URQ3 3.62e-24 113 23 13 434 3 napA Periplasmic nitrate reductase Histophilus somni (strain 2336)
A8LLY9 3.68e-24 113 23 24 696 3 napA Periplasmic nitrate reductase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q9CKL8 3.92e-24 113 24 16 505 3 napA Periplasmic nitrate reductase Pasteurella multocida (strain Pm70)
Q0I5G9 5.92e-24 112 23 13 434 3 napA Periplasmic nitrate reductase Histophilus somni (strain 129Pt)
A8AE11 7.17e-24 112 23 15 487 3 napA Periplasmic nitrate reductase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q06457 7.48e-24 112 25 7 277 2 nasA Nitrate reductase Klebsiella oxytoca
B7VRL0 7.76e-24 112 24 15 488 3 napA Periplasmic nitrate reductase Vibrio atlanticus (strain LGP32)
A4SPG7 1.21e-23 111 23 22 648 3 napA Periplasmic nitrate reductase Aeromonas salmonicida (strain A449)
Q5E3J6 1.66e-23 110 22 22 661 3 napA Periplasmic nitrate reductase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FGW1 1.82e-23 110 22 21 661 3 napA Periplasmic nitrate reductase Aliivibrio fischeri (strain MJ11)
Q6LTV9 2.52e-23 110 23 17 492 3 napA1 Periplasmic nitrate reductase 1 Photobacterium profundum (strain SS9)
B5RC85 2.68e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella gallinarum (strain 287/91 / NCTC 13346)
C0Q0P2 2.82e-23 110 23 14 487 3 napA Periplasmic nitrate reductase Salmonella paratyphi C (strain RKS4594)
B5FNQ2 2.84e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella dublin (strain CT_02021853)
Q87GW6 2.97e-23 110 23 14 487 3 napA Periplasmic nitrate reductase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8ZNH6 3.07e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4SYT3 3.07e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella newport (strain SL254)
B4TAT3 3.07e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella heidelberg (strain SL476)
B5R233 3.07e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella enteritidis PT4 (strain P125109)
Q57M92 3.07e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella choleraesuis (strain SC-B67)
B5EYU5 3.07e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella agona (strain SL483)
B4TPE6 3.13e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella schwarzengrund (strain CVM19633)
A7N7J3 3.38e-23 110 24 14 487 3 napA Periplasmic nitrate reductase Vibrio campbellii (strain ATCC BAA-1116)
Q8Z570 3.5e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella typhi
B5BDZ4 3.5e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella paratyphi A (strain AKU_12601)
A9N5G2 3.5e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PI61 3.5e-23 110 23 13 486 3 napA Periplasmic nitrate reductase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A6VQY7 4.79e-23 109 23 13 445 3 napA Periplasmic nitrate reductase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0UCB6 5.95e-23 109 22 22 662 3 napA Periplasmic nitrate reductase Methylobacterium sp. (strain 4-46)
A1JL26 6.04e-23 109 24 16 487 3 napA Periplasmic nitrate reductase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5B7B9 6.92e-23 108 25 17 491 3 napA Periplasmic nitrate reductase Edwardsiella ictaluri (strain 93-146)
Q8EIJ1 1.1e-22 108 23 12 487 3 napA Periplasmic nitrate reductase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q83QV0 1.13e-22 108 21 22 687 3 napA Periplasmic nitrate reductase Shigella flexneri
B8F7K2 1.31e-22 108 22 20 612 3 napA Periplasmic nitrate reductase Glaesserella parasuis serovar 5 (strain SH0165)
Q0T2R8 1.49e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Shigella flexneri serotype 5b (strain 8401)
A1VZC8 1.49e-22 108 22 16 512 3 napA Periplasmic nitrate reductase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q12P44 1.51e-22 107 23 13 437 3 napA Periplasmic nitrate reductase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A4Z0A1 1.56e-22 107 22 38 968 3 napA Periplasmic nitrate reductase Bradyrhizobium sp. (strain ORS 278)
B1JSJ0 1.72e-22 107 24 17 487 3 napA Periplasmic nitrate reductase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q668I0 1.72e-22 107 24 17 487 3 napA Periplasmic nitrate reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TMK8 1.72e-22 107 24 17 487 3 napA Periplasmic nitrate reductase Yersinia pestis (strain Pestoides F)
A9QZL3 1.72e-22 107 24 17 487 3 napA Periplasmic nitrate reductase Yersinia pestis bv. Antiqua (strain Angola)
B2K970 1.72e-22 107 24 17 487 3 napA Periplasmic nitrate reductase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FG75 1.72e-22 107 24 17 487 3 napA Periplasmic nitrate reductase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q487G4 1.95e-22 107 23 21 659 3 napA Periplasmic nitrate reductase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C6DK59 2.11e-22 107 23 15 491 3 napA Periplasmic nitrate reductase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7ZP28 2.11e-22 107 21 21 686 3 napA Periplasmic nitrate reductase Escherichia coli O139:H28 (strain E24377A / ETEC)
B5YWZ7 2.13e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE47 2.13e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli O157:H7
Q1CK03 2.16e-22 107 24 17 487 3 napA Periplasmic nitrate reductase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCF3 2.16e-22 107 24 17 487 3 napA Periplasmic nitrate reductase Yersinia pestis
Q1C5S8 2.16e-22 107 24 17 487 3 napA Periplasmic nitrate reductase Yersinia pestis bv. Antiqua (strain Antiqua)
Q3Z001 2.24e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Shigella sonnei (strain Ss046)
B7LJU7 2.24e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I1A4 2.24e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli (strain SE11)
B7N5G7 2.24e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IY66 2.24e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8CVW4 2.24e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A268 2.24e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli O9:H4 (strain HS)
B1LKV2 2.38e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli (strain SMS-3-5 / SECEC)
Q0TFN6 2.38e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q65Q72 2.47e-22 107 22 12 447 3 napA Periplasmic nitrate reductase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B7NN18 2.55e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7M5P6 2.6e-22 107 21 21 686 3 napA Periplasmic nitrate reductase Escherichia coli O8 (strain IAI1)
B7LAM9 2.6e-22 107 21 21 686 3 napA Periplasmic nitrate reductase Escherichia coli (strain 55989 / EAEC)
B7UFL9 2.71e-22 107 21 22 687 3 napA Periplasmic nitrate reductase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P33937 2.86e-22 107 21 20 660 1 napA Periplasmic nitrate reductase Escherichia coli (strain K12)
B1X8A2 2.86e-22 107 21 20 660 3 napA Periplasmic nitrate reductase Escherichia coli (strain K12 / DH10B)
C4ZU48 2.86e-22 107 21 20 660 3 napA Periplasmic nitrate reductase Escherichia coli (strain K12 / MC4100 / BW2952)
Q5HV12 3.4e-22 107 22 17 516 3 napA Periplasmic nitrate reductase Campylobacter jejuni (strain RM1221)
Q9PPD9 3.4e-22 107 22 17 516 3 napA Periplasmic nitrate reductase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B7MXN6 3.6e-22 106 21 21 686 3 napA Periplasmic nitrate reductase Escherichia coli O81 (strain ED1a)
A8FLJ3 3.89e-22 106 22 16 512 3 napA Periplasmic nitrate reductase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q1R9L3 4.1e-22 106 21 21 686 3 napA Periplasmic nitrate reductase Escherichia coli (strain UTI89 / UPEC)
A1AD59 4.1e-22 106 21 21 686 3 napA Periplasmic nitrate reductase Escherichia coli O1:K1 / APEC
B7MFB8 4.1e-22 106 21 21 686 3 napA Periplasmic nitrate reductase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q31Z29 4.21e-22 106 21 20 660 3 napA Periplasmic nitrate reductase Shigella boydii serotype 4 (strain Sb227)
B2TV30 4.39e-22 106 21 20 660 3 napA Periplasmic nitrate reductase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q6D5Z2 6.41e-22 105 23 15 491 3 napA Periplasmic nitrate reductase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P77561 6.66e-22 105 24 8 391 2 ydeP Protein YdeP Escherichia coli (strain K12)
Q83RF3 6.9e-22 105 24 8 391 3 ydeP Protein YdeP Shigella flexneri
A0RQ36 8.01e-22 105 22 16 470 3 napA Periplasmic nitrate reductase Campylobacter fetus subsp. fetus (strain 82-40)
A9MJZ6 8.3e-22 105 23 14 486 3 napA Periplasmic nitrate reductase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8XAX1 8.86e-22 105 24 8 391 3 ydeP Protein YdeP Escherichia coli O157:H7
Q32I06 1.04e-21 105 21 22 687 3 napA Periplasmic nitrate reductase Shigella dysenteriae serotype 1 (strain Sd197)
B0TSW5 1.33e-21 104 23 14 491 3 napA Periplasmic nitrate reductase Shewanella halifaxensis (strain HAW-EB4)
Q7MD44 1.68e-21 104 23 15 488 3 napA Periplasmic nitrate reductase Vibrio vulnificus (strain YJ016)
Q8D623 1.98e-21 104 23 15 488 3 napA Periplasmic nitrate reductase Vibrio vulnificus (strain CMCP6)
I3R634 2.53e-21 103 26 8 265 1 nasA Assimilatory nitrate reductase Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q6LQJ3 4.49e-21 103 22 28 730 3 napA2 Periplasmic nitrate reductase 2 Photobacterium profundum (strain SS9)
P45004 6.06e-21 102 25 19 460 3 dmsA Dimethyl sulfoxide reductase DmsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A7ZCK4 8.24e-21 102 21 23 646 3 napA Periplasmic nitrate reductase Campylobacter concisus (strain 13826)
B2UBL7 8.27e-21 102 24 15 490 3 napA Periplasmic nitrate reductase Ralstonia pickettii (strain 12J)
Q8FHF8 9.25e-21 102 24 8 391 3 ydeP Protein YdeP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7VPJ7 9.27e-21 102 23 15 455 3 napA Periplasmic nitrate reductase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7M962 1.03e-20 102 22 16 523 3 napA Periplasmic nitrate reductase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A6V924 1.06e-20 102 24 18 463 3 napA Periplasmic nitrate reductase Pseudomonas aeruginosa (strain PA7)
Q2SGV7 1.2e-20 101 22 26 721 3 napA Periplasmic nitrate reductase Hahella chejuensis (strain KCTC 2396)
Q56350 1.46e-20 101 23 15 492 1 napA Periplasmic nitrate reductase Paracoccus pantotrophus
B0BR28 1.53e-20 101 22 15 480 3 napA Periplasmic nitrate reductase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2D1 1.53e-20 101 22 15 480 3 napA Periplasmic nitrate reductase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N277 1.53e-20 101 22 15 480 3 napA Periplasmic nitrate reductase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A7GZP5 1.65e-20 101 21 24 645 3 napA Periplasmic nitrate reductase Campylobacter curvus (strain 525.92)
Q53176 1.97e-20 101 21 17 620 1 napA Periplasmic nitrate reductase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A8GHJ4 2.27e-20 100 23 14 483 3 napA Periplasmic nitrate reductase Serratia proteamaculans (strain 568)
Q89EN5 2.28e-20 100 22 39 979 3 napA Periplasmic nitrate reductase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q13I15 2.51e-20 100 24 19 484 3 napA Periplasmic nitrate reductase Paraburkholderia xenovorans (strain LB400)
P18775 2.64e-20 100 24 16 502 1 dmsA Dimethyl sulfoxide reductase DmsA Escherichia coli (strain K12)
Q7VJT5 2.71e-20 100 22 14 508 3 napA Periplasmic nitrate reductase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q21PN1 3.84e-20 100 21 19 620 3 napA Periplasmic nitrate reductase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q02IZ4 3.86e-20 100 23 23 621 3 napA Periplasmic nitrate reductase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UX15 5.08e-20 99 24 18 463 3 napA Periplasmic nitrate reductase Pseudomonas aeruginosa (strain LESB58)
Q9I4G3 5.22e-20 99 24 18 463 3 napA Periplasmic nitrate reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6Q604 7.31e-20 99 22 21 542 3 napA Periplasmic nitrate reductase Nitratiruptor sp. (strain SB155-2)
C3LVU3 1.1e-19 98 21 13 486 3 napA Periplasmic nitrate reductase Vibrio cholerae serotype O1 (strain M66-2)
Q9KLR4 1.1e-19 98 21 13 486 3 napA Periplasmic nitrate reductase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5EZX9 1.1e-19 98 21 13 486 3 napA Periplasmic nitrate reductase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C1D9G3 1.25e-19 98 23 15 481 3 napA Periplasmic nitrate reductase Laribacter hongkongensis (strain HLHK9)
B9L8L4 3.08e-19 97 22 16 519 3 napA Periplasmic nitrate reductase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A7I3Y7 4.65e-19 97 21 14 472 3 napA Periplasmic nitrate reductase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q92Z36 7.84e-19 95 22 25 635 3 napA Periplasmic nitrate reductase Rhizobium meliloti (strain 1021)
P77374 1.08e-18 95 25 17 458 1 ynfE Putative dimethyl sulfoxide reductase chain YnfE Escherichia coli (strain K12)
Q8U7P1 1.09e-18 95 23 16 465 3 napA Periplasmic nitrate reductase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q7W733 2.19e-18 94 21 15 458 3 napA Periplasmic nitrate reductase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WIQ1 2.4e-18 94 21 15 458 3 napA Periplasmic nitrate reductase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q21AR4 2.4e-18 94 22 15 492 3 napA Periplasmic nitrate reductase Rhodopseudomonas palustris (strain BisB18)
P65409 8.9e-18 92 23 7 375 3 BQ2027_MB2924C Uncharacterized oxidoreductase Mb2924c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WJP9 8.9e-18 92 23 7 375 1 Rv2900c Uncharacterized oxidoreductase Rv2900c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJP8 8.9e-18 92 23 7 375 3 MT2968 Uncharacterized oxidoreductase MT2968 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P77783 1.13e-15 85 23 19 472 1 ynfF Probable dimethyl sulfoxide reductase chain YnfF Escherichia coli (strain K12)
P37519 5.11e-15 83 23 16 426 3 yyaE Probable oxidoreductase YyaE Bacillus subtilis (strain 168)
A4XWM0 1.07e-14 82 22 17 457 3 napA Periplasmic nitrate reductase Pseudomonas mendocina (strain ymp)
Q3HS05 2.37e-14 81 21 14 452 3 napA Periplasmic nitrate reductase Stutzerimonas stutzeri
A4VJ11 2.37e-14 81 21 14 452 3 napA Periplasmic nitrate reductase Stutzerimonas stutzeri (strain A1501)
Q71EW5 5.77e-14 80 25 7 264 1 None Acetylene hydratase Syntrophotalea acetylenica
C0SP82 4.52e-13 77 22 14 409 3 yoaE Probable oxidoreductase YoaE Bacillus subtilis (strain 168)
P37600 1.72e-11 72 24 10 311 1 phsA Thiosulfate reductase molybdopterin-containing subunit PhsA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P31075 4.81e-11 70 25 12 268 1 psrA Polysulfide reductase chain A Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
I3R9M9 1.29e-10 69 22 21 517 1 narG Respiratory nitrate reductase subunit alpha Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q9HR74 3.7e-10 67 25 7 251 2 dmsA Putative dimethyl sulfoxide reductase catalytic subunit A Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9S1H0 5.2e-10 67 22 12 415 1 serA Selenate reductase subunit alpha Thauera selenatis
Q7WTU0 2.07e-09 65 23 10 314 1 arrA Arsenate respiratory reductase molybdopterin-containing subunit ArrA Shewanella sp. (strain ANA-3)
A0A369NIV7 1.17e-08 63 23 13 324 1 dadH Dopamine dehydroxylase Eggerthella lenta
C8WLC6 1.21e-08 63 23 13 324 2 Elen_0471 Uncharacterized oxidoreductase Elen_0471 Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)
Q8GGJ6 1.7e-08 62 22 13 339 2 aioA Arsenite oxidase subunit AioA Herminiimonas arsenicoxydans
P60068 4.02e-08 61 20 11 431 1 clrA Chlorate reductase subunit alpha Ideonella dechloratans
P56914 1.05e-07 60 25 6 221 3 nuoG2 NADH-quinone oxidoreductase subunit G 2 Rhizobium meliloti (strain 1021)
Q8GPG4 1.45e-07 59 20 11 422 1 ddhA Dimethylsulfide dehydrogenase subunit alpha Rhodovulum sulfidophilum
Q6LWL8 3.46e-07 57 25 6 201 3 fwdB Tungsten-containing formylmethanofuran dehydrogenase 2 subunit B Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q74FU6 1.04e-06 56 23 5 239 1 sfrA NADPH-Fe(3+) oxidoreductase subunit alpha Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q74FU6 5.18e-05 51 22 9 261 1 sfrA NADPH-Fe(3+) oxidoreductase subunit alpha Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
D7AF63 1.04e-06 56 23 5 239 3 sfrA NADPH-Fe(3+) oxidoreductase subunit alpha Geobacter sulfurreducens (strain DL-1 / KN400)
D7AF63 5.18e-05 51 22 9 261 3 sfrA NADPH-Fe(3+) oxidoreductase subunit alpha Geobacter sulfurreducens (strain DL-1 / KN400)
Q7SIF4 1.19e-06 56 22 15 338 1 aioA Arsenite oxidase subunit AioA Alcaligenes faecalis
P61154 5.16e-06 53 25 7 204 3 fwdB Tungsten-containing formylmethanofuran dehydrogenase 2 subunit B Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P44798 7.45e-06 53 19 11 380 1 torZ Trimethylamine-N-oxide reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15395
Feature type CDS
Gene fdnG
Product formate dehydrogenase-N subunit alpha
Location 3420023 - 3423070 (strand: -1)
Length 3048 (nucleotides) / 1015 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_72
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00384 Molybdopterin oxidoreductase
PF01568 Molydopterin dinucleotide binding domain
PF04879 Molybdopterin oxidoreductase Fe4S4 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3383 General function prediction only (R) R Predicted molibdopterin-dependent oxidoreductase YjgC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08348 formate dehydrogenase-N, alpha subunit [EC:1.17.5.3] Two-component system -

Protein Sequence

MQVSRRQFFKICAGGMAGTTAAALGFAPAVALAGSRQYKLLRARETRNTCTYCSVGCGLLMYSLGDGAKNAKETIFHIEGDPDHPVNRGALCPKGAGLVDFIHSKGRLQYPEYRAPGSDKWVKLSWEETFDRIARLMKKDRDANFEKFNKEGVEVNRWLSTGMLCASAASNETGFLTQKFSRALGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDMKNANLIVVMGGNAAEAHPVGFRWAMEAKIHNKAKLIVIDPRFTRTASVADFYTPIRSGTDITFLSGVILYLLENKKYQKEYVEAYTNASLIVREDYHFDDGLFSGYDPEKRQYDKTTWNYEMDENGFAKRDTTLQHPRCVWNLLKEHVSRYTPDVVTQICGTPKEDFLKVCEYIAETAAKDKTASFLYALGWTQHTVGAQNIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQGLTDLGLLSQSLPGYLTLPSEKQTSLETYLAANTPKPTVQGQVNYWGNYPKFFVSMMKTFYGDHAQRDNDWGFSLLPKWDKPYDVLQYFEMMDKGEVNGYICQGFNPVASFPNKNKVIRSLSKLKFLITMDPLNTETSCFWQNHGEENDVKTADIQTEVFRLPTTCFAEENGSIVNSGRWLQWHWKGADAPGIALPDGEILSGIFHRLRQLYKEEGGAMPEQVLNMTWDYFDPNNPTSEEVAQESNGKALVDLKDADGNIILKKGQQLSSFAQLRDDGTTASGCWIFAGSWTENGNQMANRDNSDPSGLGNTLGWAWAWPLNRRIIYNRASADPQGQPWDPKRKLIEWDGSKWTGIDVPDYSNAAPGSDVGPFIMQPEGMGRLFAIDKMAEGPFPEHYEPIETPLGTNPLHPNVVSNPAARVFKDDWEEMGKAEEFPYVGTTYRLTEHFHFWTKHALLNAIIQPQQFIEIGERLAAEKGISQGDTVKVSSKRGYIKAKAVVTKRIRTLDVDGRKVDTIGIPIHWGFEGVAVKGFIANTLTPFVGDANTQTPEFKAFLVNVEKV

Flanking regions ( +/- flanking 50bp)

GTGAAGAAAATCAGAGTCAGTAAAAGCAATGTATGATGAGGAGAGACCCCATGCAGGTCAGCAGAAGACAGTTCTTTAAGATCTGTGCTGGCGGTATGGCAGGTACTACAGCGGCTGCCTTAGGTTTTGCACCCGCTGTTGCGTTAGCAGGCTCACGTCAGTATAAATTACTGCGTGCCCGTGAAACTCGCAATACCTGTACGTACTGTTCTGTCGGTTGTGGACTATTAATGTATAGTCTGGGCGATGGCGCGAAAAACGCAAAAGAAACCATATTCCATATTGAAGGTGATCCTGACCACCCAGTAAACCGTGGTGCACTTTGTCCTAAAGGTGCTGGTCTCGTTGATTTTATCCATAGTAAAGGCCGTTTACAATATCCTGAATATCGTGCTCCCGGCTCAGATAAATGGGTAAAACTTTCATGGGAAGAGACCTTTGATCGTATCGCACGCTTAATGAAAAAAGATCGCGATGCCAACTTCGAAAAATTCAATAAAGAAGGTGTTGAAGTAAACCGTTGGTTATCAACGGGGATGCTTTGTGCCTCCGCAGCAAGTAACGAAACAGGCTTTTTGACCCAGAAATTCTCAAGAGCACTTGGGATGCTGGCTGTCGACAACCAAGCGCGTGTCTGACACGGACCAACGGTAGCAAGTCTTGCTCCAACATTTGGTCGCGGTGCGATGACCAACCACTGGGTTGATATGAAAAATGCCAACCTTATCGTCGTTATGGGCGGTAATGCGGCTGAAGCACACCCTGTCGGTTTCCGCTGGGCAATGGAAGCTAAAATCCATAATAAAGCCAAGTTAATTGTGATTGATCCTCGCTTCACACGTACTGCGTCTGTTGCGGATTTCTATACGCCTATTCGTTCAGGTACAGATATCACCTTCTTATCGGGGGTTATCTTATATCTGCTCGAAAATAAAAAATATCAAAAAGAGTACGTTGAGGCTTATACCAATGCCAGCTTGATTGTGCGCGAAGATTACCATTTTGATGATGGTCTCTTTAGTGGTTACGATCCTGAAAAACGTCAATATGATAAAACCACTTGGAATTACGAGATGGATGAAAATGGTTTCGCTAAACGCGACACCACGCTTCAACATCCTCGTTGTGTCTGGAATCTATTAAAAGAACACGTTAGTCGCTACACACCTGATGTGGTCACTCAGATTTGCGGTACACCAAAAGAAGATTTCTTAAAAGTCTGTGAATATATTGCTGAAACAGCAGCGAAAGATAAAACAGCCTCTTTCCTGTATGCATTAGGCTGGACTCAACACACTGTTGGTGCACAAAACATTCGTACTATGGCGATGATCCAATTACTGTTAGGTAATATGGGTATGGCAGGTGGCGGTGTTAATGCTCTACGTGGTCACTCTAATATTCAAGGCTTAACAGATCTTGGTCTGTTATCACAAAGCTTACCGGGTTACCTAACCTTGCCTTCTGAAAAGCAAACATCGTTAGAAACCTATTTAGCAGCCAATACGCCAAAACCGACCGTCCAAGGGCAGGTTAACTACTGGGGTAACTATCCTAAATTCTTCGTCAGTATGATGAAGACATTTTATGGTGATCATGCTCAACGTGATAACGATTGGGGATTCTCACTATTACCTAAATGGGATAAACCATACGACGTTCTGCAATATTTCGAAATGATGGATAAAGGTGAAGTCAATGGCTATATCTGCCAAGGCTTTAACCCTGTAGCTTCATTCCCGAATAAGAACAAAGTGATCCGTTCATTATCAAAACTGAAATTCCTTATCACCATGGATCCGTTAAATACAGAAACATCTTGTTTCTGGCAAAACCACGGTGAAGAGAATGATGTGAAAACAGCAGATATCCAAACTGAAGTTTTCCGTCTACCTACGACTTGTTTTGCTGAAGAGAACGGCTCTATTGTTAACTCAGGACGCTGGTTACAATGGCACTGGAAAGGTGCTGATGCCCCAGGAATTGCACTGCCTGATGGTGAAATTCTCTCAGGTATTTTCCATCGTTTACGCCAACTTTATAAAGAAGAAGGTGGCGCAATGCCTGAGCAGGTGTTGAATATGACTTGGGATTACTTTGATCCTAATAATCCAACATCTGAAGAAGTGGCTCAAGAGAGCAATGGTAAAGCCCTTGTCGACTTAAAAGACGCTGATGGCAATATCATTTTGAAGAAAGGTCAGCAACTAAGCTCATTTGCTCAGTTACGTGATGATGGTACAACGGCAAGTGGCTGTTGGATCTTCGCGGGTAGCTGGACAGAAAACGGCAACCAAATGGCTAACCGTGATAACTCAGACCCATCAGGTTTGGGTAACACATTAGGTTGGGCGTGGGCATGGCCTTTAAACCGTCGCATTATTTACAACCGTGCATCAGCAGATCCACAAGGTCAACCATGGGATCCAAAACGCAAGTTAATCGAATGGGATGGTAGCAAATGGACAGGTATTGATGTACCTGACTATAGCAATGCCGCACCAGGCTCTGATGTTGGTCCATTTATTATGCAACCTGAAGGTATGGGGCGTTTATTCGCTATCGACAAGATGGCAGAAGGTCCATTCCCTGAACACTATGAGCCAATTGAAACCCCATTAGGTACCAACCCACTGCATCCAAATGTTGTTTCAAACCCAGCAGCACGTGTGTTTAAAGATGACTGGGAAGAGATGGGTAAAGCAGAAGAGTTCCCATATGTAGGTACGACTTACCGTCTGACTGAGCATTTCCACTTCTGGACAAAACATGCGCTGTTAAATGCCATTATTCAGCCTCAACAATTTATCGAAATCGGTGAACGGTTAGCGGCAGAAAAAGGTATTTCTCAAGGTGACACCGTTAAAGTCAGTTCCAAACGTGGTTACATTAAAGCAAAAGCTGTAGTGACCAAACGTATTAGAACACTTGATGTTGATGGTCGCAAAGTGGATACCATTGGTATTCCGATCCACTGGGGTTTTGAAGGGGTTGCGGTTAAAGGCTTTATTGCTAATACCCTAACGCCATTCGTCGGTGATGCAAATACACAAACGCCAGAATTTAAAGCGTTCCTTGTTAATGTGGAAAAGGTGTAAGGAGATAAATTATGTCACTGCAATCACAAGACATTATTCGTCGCTCTGCC