Homologs in group_72

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08060 FBDBKF_08060 76.3 Morganella morganii S1 fdnG formate dehydrogenase-N subunit alpha
FBDBKF_16120 FBDBKF_16120 100.0 Morganella morganii S1 fdnG formate dehydrogenase-N subunit alpha
EHELCC_13890 EHELCC_13890 76.3 Morganella morganii S2 fdnG formate dehydrogenase-N subunit alpha
EHELCC_16155 EHELCC_16155 100.0 Morganella morganii S2 fdnG formate dehydrogenase-N subunit alpha
NLDBIP_14335 NLDBIP_14335 76.3 Morganella morganii S4 fdnG formate dehydrogenase-N subunit alpha
NLDBIP_17185 NLDBIP_17185 100.0 Morganella morganii S4 fdnG formate dehydrogenase-N subunit alpha
LHKJJB_08515 LHKJJB_08515 76.3 Morganella morganii S3 fdnG formate dehydrogenase-N subunit alpha
LHKJJB_17105 LHKJJB_17105 100.0 Morganella morganii S3 fdnG formate dehydrogenase-N subunit alpha
HKOGLL_08065 HKOGLL_08065 76.3 Morganella morganii S5 fdnG formate dehydrogenase-N subunit alpha
F4V73_RS12935 F4V73_RS12935 75.6 Morganella psychrotolerans fdnG formate dehydrogenase-N subunit alpha
F4V73_RS17495 F4V73_RS17495 96.5 Morganella psychrotolerans fdnG formate dehydrogenase-N subunit alpha
PMI_RS15395 PMI_RS15395 88.0 Proteus mirabilis HI4320 fdnG formate dehydrogenase-N subunit alpha

Distribution of the homologs in the orthogroup group_72

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_72

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P32176 0.0 1820 83 1 1016 1 fdoG Formate dehydrogenase-O major subunit Escherichia coli (strain K12)
P24183 0.0 1701 76 0 1015 1 fdnG Formate dehydrogenase, nitrate-inducible, major subunit Escherichia coli (strain K12)
P46448 0.0 1363 61 3 1026 3 fdxG Formate dehydrogenase major subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q934F5 0.0 835 42 17 1031 1 fdhA Formate dehydrogenase subunit alpha Megalodesulfovibrio gigas
Q727P3 0.0 828 43 18 1030 1 fdnG-3 Formate dehydrogenase 2 subunit alpha (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P06131 6.02e-76 267 30 13 612 1 fdhA Formate dehydrogenase subunit alpha Methanobacterium formicicum
P06131 6.1e-05 50 32 6 133 1 fdhA Formate dehydrogenase subunit alpha Methanobacterium formicicum
P61159 6.01e-65 235 28 15 612 3 fdhA Formate dehydrogenase subunit alpha Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P61159 1.47e-07 59 28 5 164 3 fdhA Formate dehydrogenase subunit alpha Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P07658 5.79e-46 180 26 18 626 1 fdhF Formate dehydrogenase H Escherichia coli (strain K12)
Q7A057 1.51e-42 172 24 17 646 3 MW2229 Putative formate dehydrogenase MW2229 Staphylococcus aureus (strain MW2)
Q6G711 1.51e-42 172 24 17 646 3 SAS2201 Putative formate dehydrogenase SAS2201 Staphylococcus aureus (strain MSSA476)
Q99RW4 1.51e-42 172 24 17 646 1 SA2102 Putative formate dehydrogenase SA2102 Staphylococcus aureus (strain N315)
Q5HDP9 1.63e-42 172 24 17 646 3 SACOL2301 Putative formate dehydrogenase SACOL2301 Staphylococcus aureus (strain COL)
Q2FVV9 1.63e-42 172 24 17 646 3 SAOUHSC_02582 Putative formate dehydrogenase SAOUHSC_02582 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEI5 1.63e-42 172 24 17 646 3 SAUSA300_2258 Putative formate dehydrogenase SAUSA300_2258 Staphylococcus aureus (strain USA300)
P73448 2.6e-42 169 25 15 621 3 narB Nitrate reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P73448 1.21e-06 56 28 4 133 3 narB Nitrate reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6GEC4 3.14e-42 171 24 17 646 3 SAR2393 Putative formate dehydrogenase SAR2393 Staphylococcus aureus (strain MRSA252)
Q931G2 4.62e-42 171 24 17 646 3 SAV2309 Putative formate dehydrogenase SAV2309 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YYT1 1.03e-41 169 24 17 646 3 SAB2186c Putative formate dehydrogenase SAB2186c Staphylococcus aureus (strain bovine RF122 / ET3-1)
O34720 1.66e-41 169 24 17 645 3 yjgC Probable oxidoreductase YjgC Bacillus subtilis (strain 168)
O34720 1.13e-05 53 30 3 120 3 yjgC Probable oxidoreductase YjgC Bacillus subtilis (strain 168)
Q49ZN0 5.53e-40 164 23 17 642 3 SSP0601 Putative formate dehydrogenase SSP0601 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L8G8 1.08e-39 163 24 14 622 3 SH0748 Putative formate dehydrogenase SH0748 Staphylococcus haemolyticus (strain JCSC1435)
O33732 5.29e-39 160 23 13 605 3 Sfri_1505 Nitrate reductase Shewanella frigidimarina (strain NCIMB 400)
Q795Y4 7.15e-39 160 24 13 621 3 yrhE Putative formate dehydrogenase YrhE Bacillus subtilis (strain 168)
Q795Y4 1.46e-05 53 29 5 148 3 yrhE Putative formate dehydrogenase YrhE Bacillus subtilis (strain 168)
Q67QZ1 1.67e-38 158 25 22 666 3 napA Nitrate reductase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q67QZ1 0.0006 47 29 3 131 3 napA Nitrate reductase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P81186 1.85e-35 148 24 17 653 1 napA Periplasmic nitrate reductase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q47A87 8.59e-33 140 24 20 661 3 napA Periplasmic nitrate reductase Dechloromonas aromatica (strain RCB)
P42434 1.04e-32 139 23 19 613 2 nasC Assimilatory nitrate reductase catalytic subunit Bacillus subtilis (strain 168)
Q2W3T1 1.79e-31 136 23 20 618 3 napA Periplasmic nitrate reductase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A9I7M5 1.94e-30 133 26 16 509 3 napA Periplasmic nitrate reductase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
P39185 1.75e-29 130 22 19 667 1 napA Periplasmic nitrate reductase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q93HX3 1.92e-29 130 25 16 461 3 napA Periplasmic nitrate reductase Paramagnetospirillum magnetotacticum
A0KIM1 1.29e-28 127 22 17 613 3 napA Periplasmic nitrate reductase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q46RX3 3.07e-28 126 22 19 670 3 napA Periplasmic nitrate reductase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A4SPG7 3.17e-28 126 23 17 612 3 napA Periplasmic nitrate reductase Aeromonas salmonicida (strain A449)
A1SWQ0 3.41e-28 125 23 15 506 3 napA Periplasmic nitrate reductase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A8LLY9 4.09e-28 125 23 22 715 3 napA Periplasmic nitrate reductase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q8VL02 7.39e-28 125 25 14 440 3 napA Periplasmic nitrate reductase Aggregatibacter actinomycetemcomitans
Q9CKL8 8.34e-28 124 25 16 505 3 napA Periplasmic nitrate reductase Pasteurella multocida (strain Pm70)
P39458 8.46e-28 124 29 8 279 1 narB Nitrate reductase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P39458 3.5e-05 51 33 4 130 1 narB Nitrate reductase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B0URQ3 1.5e-27 124 25 14 434 3 napA Periplasmic nitrate reductase Histophilus somni (strain 2336)
Q4QNJ6 2.05e-27 123 24 22 665 3 napA Periplasmic nitrate reductase Haemophilus influenzae (strain 86-028NP)
Q0I5G9 2.43e-27 123 25 14 434 3 napA Periplasmic nitrate reductase Histophilus somni (strain 129Pt)
Q87GW6 2.93e-27 123 22 20 661 3 napA Periplasmic nitrate reductase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B1Y6A6 3.04e-27 123 24 23 662 3 napA Periplasmic nitrate reductase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B3R8B4 5.25e-27 122 22 19 667 3 napA Periplasmic nitrate reductase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A5UAE1 5.49e-27 122 24 21 663 3 napA Periplasmic nitrate reductase Haemophilus influenzae (strain PittEE)
C6DK59 6e-27 122 23 21 661 3 napA Periplasmic nitrate reductase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A9MJZ6 1.19e-26 121 22 20 661 3 napA Periplasmic nitrate reductase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7N7J3 1.32e-26 120 23 21 661 3 napA Periplasmic nitrate reductase Vibrio campbellii (strain ATCC BAA-1116)
B5RC85 2.14e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q12P44 2.18e-26 120 22 18 628 3 napA Periplasmic nitrate reductase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8ZNH6 2.21e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4SYT3 2.21e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella newport (strain SL254)
B4TAT3 2.21e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella heidelberg (strain SL476)
B5R233 2.21e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella enteritidis PT4 (strain P125109)
Q57M92 2.21e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella choleraesuis (strain SC-B67)
B5EYU5 2.21e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella agona (strain SL483)
Q6D5Z2 2.23e-26 120 22 21 661 3 napA Periplasmic nitrate reductase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C0Q0P2 2.35e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella paratyphi C (strain RKS4594)
B4TPE6 2.37e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella schwarzengrund (strain CVM19633)
A8AE11 2.52e-26 120 23 14 487 3 napA Periplasmic nitrate reductase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
I3R634 2.58e-26 119 30 9 265 1 nasA Assimilatory nitrate reductase Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q1R9L3 2.61e-26 120 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli (strain UTI89 / UPEC)
A1AD59 2.61e-26 120 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O1:K1 / APEC
B7MFB8 2.61e-26 120 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O45:K1 (strain S88 / ExPEC)
B5FNQ2 2.63e-26 120 22 20 661 3 napA Periplasmic nitrate reductase Salmonella dublin (strain CT_02021853)
B7MXN6 2.63e-26 120 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O81 (strain ED1a)
B8F7K2 2.99e-26 119 22 17 610 3 napA Periplasmic nitrate reductase Glaesserella parasuis serovar 5 (strain SH0165)
Q83QV0 3.78e-26 119 21 18 660 3 napA Periplasmic nitrate reductase Shigella flexneri
Q32I06 3.95e-26 119 21 18 660 3 napA Periplasmic nitrate reductase Shigella dysenteriae serotype 1 (strain Sd197)
A6VQY7 4.32e-26 119 24 13 445 3 napA Periplasmic nitrate reductase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q8Z570 4.45e-26 119 22 20 661 3 napA Periplasmic nitrate reductase Salmonella typhi
B5BDZ4 4.45e-26 119 22 20 661 3 napA Periplasmic nitrate reductase Salmonella paratyphi A (strain AKU_12601)
A9N5G2 4.45e-26 119 22 20 661 3 napA Periplasmic nitrate reductase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PI61 4.45e-26 119 22 20 661 3 napA Periplasmic nitrate reductase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7ZP28 4.94e-26 119 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0T2R8 5.29e-26 119 21 18 660 3 napA Periplasmic nitrate reductase Shigella flexneri serotype 5b (strain 8401)
Q31Z29 6.51e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Shigella boydii serotype 4 (strain Sb227)
P33937 6.63e-26 118 21 18 660 1 napA Periplasmic nitrate reductase Escherichia coli (strain K12)
B1X8A2 6.63e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli (strain K12 / DH10B)
C4ZU48 6.63e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli (strain K12 / MC4100 / BW2952)
Q6LTV9 6.86e-26 118 21 20 665 3 napA1 Periplasmic nitrate reductase 1 Photobacterium profundum (strain SS9)
Q3Z001 6.98e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Shigella sonnei (strain Ss046)
B7LJU7 6.98e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I1A4 6.98e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli (strain SE11)
B7N5G7 6.98e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IY66 6.98e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8CVW4 6.98e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A268 6.98e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O9:H4 (strain HS)
B7NN18 7.22e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
C5B7B9 7.43e-26 118 23 22 664 3 napA Periplasmic nitrate reductase Edwardsiella ictaluri (strain 93-146)
B2TV30 7.61e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LKV2 8.15e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli (strain SMS-3-5 / SECEC)
Q0TFN6 8.15e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UFL9 9.28e-26 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q65Q72 9.98e-26 118 22 20 622 3 napA Periplasmic nitrate reductase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B7M5P6 1.01e-25 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O8 (strain IAI1)
B7LAM9 1.01e-25 118 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli (strain 55989 / EAEC)
Q06457 1.32e-25 117 28 8 284 2 nasA Nitrate reductase Klebsiella oxytoca
A5ED21 1.48e-25 117 22 19 666 3 napA Periplasmic nitrate reductase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4Z0A1 2.08e-25 117 22 18 663 3 napA Periplasmic nitrate reductase Bradyrhizobium sp. (strain ORS 278)
B7VRL0 2.11e-25 117 24 16 490 3 napA Periplasmic nitrate reductase Vibrio atlanticus (strain LGP32)
B5YWZ7 2.38e-25 117 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE47 2.38e-25 117 21 18 660 3 napA Periplasmic nitrate reductase Escherichia coli O157:H7
Q7MD44 3.06e-25 116 22 19 661 3 napA Periplasmic nitrate reductase Vibrio vulnificus (strain YJ016)
Q8D623 3.28e-25 116 22 19 661 3 napA Periplasmic nitrate reductase Vibrio vulnificus (strain CMCP6)
B0UCB6 4.66e-25 115 21 19 617 3 napA Periplasmic nitrate reductase Methylobacterium sp. (strain 4-46)
Q5E3J6 9.72e-25 115 21 19 661 3 napA Periplasmic nitrate reductase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B9KCQ2 1.15e-24 115 22 15 512 3 napA Periplasmic nitrate reductase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B5FGW1 1.23e-24 114 21 19 661 3 napA Periplasmic nitrate reductase Aliivibrio fischeri (strain MJ11)
D3RNN8 2.71e-24 114 23 12 452 1 soeA Sulfite dehydrogenase subunit A Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
B0TSW5 2.94e-24 113 24 14 491 3 napA Periplasmic nitrate reductase Shewanella halifaxensis (strain HAW-EB4)
Q487G4 3.1e-24 113 22 17 659 3 napA Periplasmic nitrate reductase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7VPJ7 3.24e-24 113 24 17 455 3 napA Periplasmic nitrate reductase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A0RQ36 3.45e-24 113 23 17 473 3 napA Periplasmic nitrate reductase Campylobacter fetus subsp. fetus (strain 82-40)
A7GZP5 4.59e-24 113 23 16 473 3 napA Periplasmic nitrate reductase Campylobacter curvus (strain 525.92)
Q53176 8.2e-24 112 22 19 622 1 napA Periplasmic nitrate reductase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q56350 8.34e-24 112 24 15 494 1 napA Periplasmic nitrate reductase Paracoccus pantotrophus
A1JL26 9.74e-24 111 22 19 660 3 napA Periplasmic nitrate reductase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B0BR28 1.11e-23 111 21 20 619 3 napA Periplasmic nitrate reductase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2D1 1.11e-23 111 21 20 619 3 napA Periplasmic nitrate reductase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N277 1.11e-23 111 21 20 619 3 napA Periplasmic nitrate reductase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VJT5 1.15e-23 111 23 14 507 3 napA Periplasmic nitrate reductase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q2SGV7 1.19e-23 111 22 21 660 3 napA Periplasmic nitrate reductase Hahella chejuensis (strain KCTC 2396)
A1VZC8 1.38e-23 111 23 18 512 3 napA Periplasmic nitrate reductase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A6V924 1.71e-23 110 23 19 615 3 napA Periplasmic nitrate reductase Pseudomonas aeruginosa (strain PA7)
Q13I15 1.74e-23 110 25 20 488 3 napA Periplasmic nitrate reductase Paraburkholderia xenovorans (strain LB400)
Q8EIJ1 1.96e-23 110 24 13 487 3 napA Periplasmic nitrate reductase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q02IZ4 2.61e-23 110 23 19 615 3 napA Periplasmic nitrate reductase Pseudomonas aeruginosa (strain UCBPP-PA14)
A8FLJ3 2.92e-23 110 23 18 512 3 napA Periplasmic nitrate reductase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7I3Y7 3.28e-23 110 22 23 647 3 napA Periplasmic nitrate reductase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B7UX15 3.88e-23 109 23 19 615 3 napA Periplasmic nitrate reductase Pseudomonas aeruginosa (strain LESB58)
Q9I4G3 4.2e-23 109 23 19 615 3 napA Periplasmic nitrate reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5HV12 4.45e-23 109 23 19 516 3 napA Periplasmic nitrate reductase Campylobacter jejuni (strain RM1221)
Q9PPD9 4.45e-23 109 23 19 516 3 napA Periplasmic nitrate reductase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8GHJ4 5.43e-23 109 22 20 661 3 napA Periplasmic nitrate reductase Serratia proteamaculans (strain 568)
Q21PN1 5.79e-23 109 21 18 623 3 napA Periplasmic nitrate reductase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B2UBL7 6.06e-23 109 22 22 678 3 napA Periplasmic nitrate reductase Ralstonia pickettii (strain 12J)
Q92Z36 6.29e-23 109 22 22 640 3 napA Periplasmic nitrate reductase Rhizobium meliloti (strain 1021)
B1JSJ0 6.3e-23 109 23 15 487 3 napA Periplasmic nitrate reductase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q668I0 6.3e-23 109 23 15 487 3 napA Periplasmic nitrate reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TMK8 6.3e-23 109 23 15 487 3 napA Periplasmic nitrate reductase Yersinia pestis (strain Pestoides F)
A9QZL3 6.3e-23 109 23 15 487 3 napA Periplasmic nitrate reductase Yersinia pestis bv. Antiqua (strain Angola)
B2K970 6.3e-23 109 23 15 487 3 napA Periplasmic nitrate reductase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FG75 6.3e-23 109 23 15 487 3 napA Periplasmic nitrate reductase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CK03 6.75e-23 108 23 15 487 3 napA Periplasmic nitrate reductase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCF3 6.75e-23 108 23 15 487 3 napA Periplasmic nitrate reductase Yersinia pestis
Q1C5S8 6.75e-23 108 23 15 487 3 napA Periplasmic nitrate reductase Yersinia pestis bv. Antiqua (strain Antiqua)
Q8XAX1 7.56e-23 108 22 11 499 3 ydeP Protein YdeP Escherichia coli O157:H7
A7ZCK4 1.16e-22 108 23 16 477 3 napA Periplasmic nitrate reductase Campylobacter concisus (strain 13826)
P18775 1.44e-22 107 26 14 472 1 dmsA Dimethyl sulfoxide reductase DmsA Escherichia coli (strain K12)
Q6LQJ3 1.78e-22 107 22 24 666 3 napA2 Periplasmic nitrate reductase 2 Photobacterium profundum (strain SS9)
P77561 1.79e-22 107 22 11 499 2 ydeP Protein YdeP Escherichia coli (strain K12)
C3LVU3 2.12e-22 107 23 14 488 3 napA Periplasmic nitrate reductase Vibrio cholerae serotype O1 (strain M66-2)
Q9KLR4 2.12e-22 107 23 14 488 3 napA Periplasmic nitrate reductase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5EZX9 2.12e-22 107 23 14 488 3 napA Periplasmic nitrate reductase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C1D9G3 2.36e-22 107 23 14 481 3 napA Periplasmic nitrate reductase Laribacter hongkongensis (strain HLHK9)
Q83RF3 2.43e-22 107 22 11 499 3 ydeP Protein YdeP Shigella flexneri
B9L8L4 2.64e-22 107 22 16 517 3 napA Periplasmic nitrate reductase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q7M962 7.7e-22 105 24 18 517 3 napA Periplasmic nitrate reductase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P45004 1.96e-21 104 26 19 464 3 dmsA Dimethyl sulfoxide reductase DmsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6Q604 2.04e-21 104 22 20 537 3 napA Periplasmic nitrate reductase Nitratiruptor sp. (strain SB155-2)
Q8U7P1 2.47e-21 103 24 16 453 3 napA Periplasmic nitrate reductase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8FHF8 3.68e-21 103 24 8 385 3 ydeP Protein YdeP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7W733 1.13e-20 102 23 15 438 3 napA Periplasmic nitrate reductase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q21AR4 1.25e-20 101 21 18 664 3 napA Periplasmic nitrate reductase Rhodopseudomonas palustris (strain BisB18)
Q7WIQ1 1.27e-20 101 23 15 438 3 napA Periplasmic nitrate reductase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q89EN5 4.37e-20 100 22 20 662 3 napA Periplasmic nitrate reductase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P77374 2.19e-19 97 26 17 458 1 ynfE Putative dimethyl sulfoxide reductase chain YnfE Escherichia coli (strain K12)
P77783 8.2e-19 95 25 19 467 1 ynfF Probable dimethyl sulfoxide reductase chain YnfF Escherichia coli (strain K12)
A4XWM0 2.19e-18 94 22 14 439 3 napA Periplasmic nitrate reductase Pseudomonas mendocina (strain ymp)
P65409 6.26e-18 92 25 11 375 3 BQ2027_MB2924C Uncharacterized oxidoreductase Mb2924c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WJP9 6.26e-18 92 25 11 375 1 Rv2900c Uncharacterized oxidoreductase Rv2900c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJP8 6.26e-18 92 25 11 375 3 MT2968 Uncharacterized oxidoreductase MT2968 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P37519 9.74e-18 92 27 9 257 3 yyaE Probable oxidoreductase YyaE Bacillus subtilis (strain 168)
C0SP82 2.37e-17 90 24 15 410 3 yoaE Probable oxidoreductase YoaE Bacillus subtilis (strain 168)
Q3HS05 1.09e-16 89 22 13 452 3 napA Periplasmic nitrate reductase Stutzerimonas stutzeri
A4VJ11 1.09e-16 89 22 13 452 3 napA Periplasmic nitrate reductase Stutzerimonas stutzeri (strain A1501)
Q9S1H0 2.96e-14 81 23 12 416 1 serA Selenate reductase subunit alpha Thauera selenatis
I3R9M9 3.17e-13 77 21 15 506 1 narG Respiratory nitrate reductase subunit alpha Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P31075 3.74e-13 77 25 12 292 1 psrA Polysulfide reductase chain A Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q71EW5 6.64e-13 76 26 9 270 1 None Acetylene hydratase Syntrophotalea acetylenica
P37600 1.16e-11 72 23 7 311 1 phsA Thiosulfate reductase molybdopterin-containing subunit PhsA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60068 1.4e-11 72 21 10 435 1 clrA Chlorate reductase subunit alpha Ideonella dechloratans
Q47CW6 1.86e-10 68 23 13 330 1 pcrA Perchlorate reductase subunit alpha Dechloromonas aromatica (strain RCB)
C8WLC6 3.12e-10 68 25 13 330 2 Elen_0471 Uncharacterized oxidoreductase Elen_0471 Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)
A0A369NIV7 3.25e-10 68 25 13 330 1 dadH Dopamine dehydroxylase Eggerthella lenta
Q9HR74 4.58e-10 67 26 10 246 2 dmsA Putative dimethyl sulfoxide reductase catalytic subunit A Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q8GPG4 3.9e-09 64 21 12 415 1 ddhA Dimethylsulfide dehydrogenase subunit alpha Rhodovulum sulfidophilum
Q7WTU0 4.17e-09 64 23 10 292 1 arrA Arsenate respiratory reductase molybdopterin-containing subunit ArrA Shewanella sp. (strain ANA-3)
P56914 8.89e-09 63 26 7 226 3 nuoG2 NADH-quinone oxidoreductase subunit G 2 Rhizobium meliloti (strain 1021)
Q74FU6 7.7e-08 60 24 9 261 1 sfrA NADPH-Fe(3+) oxidoreductase subunit alpha Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q74FU6 5.79e-07 57 23 5 239 1 sfrA NADPH-Fe(3+) oxidoreductase subunit alpha Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
D7AF63 7.7e-08 60 24 9 261 3 sfrA NADPH-Fe(3+) oxidoreductase subunit alpha Geobacter sulfurreducens (strain DL-1 / KN400)
D7AF63 5.79e-07 57 23 5 239 3 sfrA NADPH-Fe(3+) oxidoreductase subunit alpha Geobacter sulfurreducens (strain DL-1 / KN400)
Q72E84 9.63e-08 60 22 7 301 1 qrcB Menaquinone reductase, molybdopterin-binding-like subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q6LWL8 1.15e-07 59 25 6 197 3 fwdB Tungsten-containing formylmethanofuran dehydrogenase 2 subunit B Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P61154 6.37e-07 56 24 7 200 3 fwdB Tungsten-containing formylmethanofuran dehydrogenase 2 subunit B Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9Z4S6 7.75e-07 57 19 15 469 1 ttrA Tetrathionate reductase subunit A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8GGJ6 1.15e-06 56 22 11 339 2 aioA Arsenite oxidase subunit AioA Herminiimonas arsenicoxydans
P44798 1.42e-06 56 22 9 237 1 torZ Trimethylamine-N-oxide reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7SIF4 4.25e-06 54 21 13 338 1 aioA Arsenite oxidase subunit AioA Alcaligenes faecalis
Q60314 6.81e-06 53 24 8 199 3 MJ0006 Uncharacterized oxidoreductase MJ0006 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16735
Feature type CDS
Gene fdnG
Product formate dehydrogenase-N subunit alpha
Location 12659 - 15706 (strand: 1)
Length 3048 (nucleotides) / 1015 (amino acids)

Contig

Accession ZDB_698
Length 62170 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_72
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00384 Molybdopterin oxidoreductase
PF01568 Molydopterin dinucleotide binding domain
PF04879 Molybdopterin oxidoreductase Fe4S4 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3383 General function prediction only (R) R Predicted molibdopterin-dependent oxidoreductase YjgC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08348 formate dehydrogenase-N, alpha subunit [EC:1.17.5.3] Two-component system -

Protein Sequence

MQVSRRQFFKICAGGMAGTTAAALGFAPAVAIAGSRQYKLLRARETRNTCTYCSVGCGLLMYSLGDGAKNAKESIFHIEGDPDHPVNRGALCPKGAGLIDFIHSESRLKYPEVREPGTNEWKRISWNEAFDRIARLIKDDRDTNFIEKNSDGVTVNRWLTTGMLCASAASNETGFVTQKFSRALGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANLVVVMGGNAAEAHPVGFRWAMEAKIHNNAKLIVIDPRFTRTAAVADFYTPIRSGTDIAFLSGVIKYLMENEKINREYVEAYTNASLIVREDYDFKNGLFTGYDPETRQYDKTTWNYELDENGFAKRDTTLQHPRCVWNKLKEHVSRYTPDVVTNICGTPKEDFLKVCEYIGETSAKDKTASFLYALGWTQHTVGAQNIRTMAMIQLLLGNMGMLGGGVNALRGHSNIQGLTDLGLLSQSLPGYLTLPSDKQTSLESYLAANTPKPTVQGQVNYWGNYPKFFVSLMKTFYGDKAQKENNWGFDWLPKWDKGYDVLRYFDMMDKGEVNGYICQGFNPLASFPNKNKVVKALSKLKFLITVDPLNTETSNFWQNHGEMNDVDPAQIQTTVFRLPSCCFAEENGSIVNSARWLQWHWKGADAPGEAISDGEILSGIFHRVRKLYEAEGGKVPEQVLNMTWNYFDRDNPTPEEVAQESNGLALVDLKDADGNVIVKKGEQLTSFAQLRDDGTTASGCWIFAGSWTPQGNQMARRDNADPTGLGNTLGWAWAWPLNRRVIYNRASADPAGKPWDPKRQILEWNGSKWIGMDVPDYSNAAPDSDVGPFIMQPEGMGRLFAIDKMAEGPFPEHYEPIETPLGTNPLHPDVVSNPAARVFKDDWAQMGKAAEFPYVGTTYRLTEHFHYWTKHSRLNAITQPQQFIEIGERLANEKGISHGDTVRVSSKRGYIKAKAVVTKRIRTLDVNGQKVDTIGIPIHWGFEGVAVKGFITNTLTPFVGDANTQTPEFKAFLVNVEKV

Flanking regions ( +/- flanking 50bp)

CTGTGGCTTATTTTGCAGCGGCATAAGAGCAATGTAATAAGGAGATCTCCATGCAAGTCAGCAGAAGACAGTTCTTTAAGATCTGCGCTGGCGGTATGGCGGGTACAACGGCAGCGGCTCTGGGCTTTGCCCCGGCGGTCGCTATTGCCGGTTCACGTCAGTATAAGCTTTTACGCGCACGTGAAACCCGTAATACCTGCACGTACTGTTCCGTCGGCTGCGGGCTGTTAATGTACAGTCTGGGTGACGGGGCAAAAAACGCCAAAGAATCTATTTTTCACATTGAAGGGGACCCGGATCATCCGGTAAACCGCGGCGCACTGTGCCCGAAAGGCGCAGGTCTGATCGATTTTATCCACAGCGAAAGTCGTCTTAAGTATCCTGAAGTCCGTGAGCCGGGCACCAACGAGTGGAAACGTATCTCGTGGAATGAGGCGTTTGATCGTATCGCCCGCCTGATTAAAGATGACCGCGATACTAACTTTATTGAAAAGAACAGCGATGGCGTTACCGTCAACCGCTGGTTAACCACCGGGATGTTATGCGCATCTGCTGCCAGTAATGAAACCGGATTTGTCACCCAGAAATTCTCCCGCGCCCTCGGCATGCTTGCCGTGGATAACCAGGCGCGTGTCTGACACGGACCTACGGTAGCAAGTCTTGCTCCGACATTTGGTCGCGGTGCCATGACCAACCACTGGGTTGATATTAAAAATGCCAACCTTGTTGTTGTGATGGGCGGAAACGCTGCGGAAGCTCACCCTGTCGGGTTCCGCTGGGCGATGGAAGCCAAAATTCATAACAATGCCAAACTGATCGTTATTGACCCGCGCTTTACCCGTACAGCGGCTGTGGCGGATTTCTACACGCCTATCCGTTCCGGTACTGATATTGCGTTTCTGTCAGGTGTCATTAAGTACCTGATGGAAAATGAAAAAATCAACCGTGAATATGTTGAGGCGTACACCAACGCCAGCCTGATCGTCCGTGAAGATTACGATTTTAAAAACGGGCTGTTCACCGGTTATGATCCTGAAACACGCCAGTACGATAAAACCACCTGGAATTACGAACTGGATGAAAACGGCTTCGCGAAACGCGATACCACACTGCAGCATCCGCGTTGTGTGTGGAACAAGCTGAAAGAGCACGTCAGCCGTTATACCCCGGATGTGGTGACCAATATCTGCGGGACGCCGAAAGAAGACTTCCTGAAAGTCTGTGAATATATCGGCGAAACCAGCGCGAAAGATAAAACCGCCTCATTCCTGTATGCACTGGGCTGGACACAGCACACTGTCGGTGCGCAGAACATCCGTACCATGGCCATGATCCAGCTGCTGCTGGGTAACATGGGGATGCTGGGCGGCGGCGTGAACGCGCTGCGCGGTCACTCCAATATCCAGGGCTTAACCGACCTGGGCCTGCTGTCTCAGAGCCTGCCGGGCTACCTGACGCTGCCGTCTGACAAACAGACGTCACTGGAAAGTTATCTGGCTGCCAACACGCCGAAACCAACGGTACAGGGCCAGGTTAACTACTGGGGCAACTATCCGAAGTTCTTTGTCAGCCTGATGAAAACCTTCTACGGTGACAAAGCGCAGAAAGAGAATAACTGGGGCTTTGACTGGCTGCCGAAGTGGGATAAAGGCTACGACGTTCTGCGTTATTTCGACATGATGGATAAAGGGGAAGTGAATGGCTATATCTGCCAGGGCTTTAACCCGTTAGCCTCATTCCCGAACAAAAACAAAGTGGTTAAGGCGCTTTCAAAACTGAAGTTCCTGATCACCGTTGACCCGCTGAATACTGAAACATCGAACTTCTGGCAGAACCACGGCGAGATGAACGATGTGGATCCGGCACAGATTCAGACCACGGTGTTCCGTCTGCCGTCCTGCTGTTTCGCGGAAGAGAACGGCTCTATCGTTAACTCTGCCCGCTGGTTACAGTGGCACTGGAAAGGCGCGGATGCCCCGGGCGAAGCTATCAGCGACGGCGAAATCCTCTCCGGGATTTTCCACCGTGTCCGCAAGCTGTATGAAGCGGAAGGCGGTAAGGTGCCTGAGCAGGTGCTTAACATGACCTGGAACTACTTTGATCGCGATAATCCGACACCGGAAGAAGTCGCTCAGGAGAGTAATGGTCTGGCGCTGGTCGATCTGAAAGATGCTGACGGCAATGTTATTGTGAAGAAAGGCGAGCAGCTCACCTCCTTCGCACAGCTGCGTGACGACGGTACCACGGCAAGCGGATGCTGGATTTTCGCCGGCAGCTGGACACCGCAGGGTAACCAGATGGCACGCCGTGATAACGCTGACCCGACCGGACTGGGTAACACTCTCGGCTGGGCGTGGGCATGGCCGCTGAACCGCCGCGTCATTTATAACCGCGCATCTGCGGACCCGGCGGGTAAACCGTGGGATCCGAAACGTCAGATTCTGGAATGGAACGGCAGCAAGTGGATCGGTATGGATGTGCCGGACTACAGCAATGCCGCGCCGGATTCGGATGTCGGGCCGTTTATCATGCAGCCGGAAGGGATGGGCCGCCTGTTTGCTATCGATAAGATGGCGGAAGGGCCGTTCCCTGAGCACTACGAGCCGATTGAAACCCCGCTCGGCACTAACCCGCTGCATCCGGATGTGGTCTCCAACCCGGCAGCCCGTGTCTTCAAAGATGACTGGGCGCAGATGGGTAAAGCAGCGGAATTCCCGTATGTCGGTACAACTTACCGTCTGACGGAGCACTTCCACTACTGGACCAAGCATTCTCGGTTAAATGCTATCACTCAGCCGCAGCAGTTTATCGAAATCGGTGAGCGTCTCGCGAATGAGAAAGGCATTTCCCATGGCGATACGGTAAGAGTCAGCTCCAAACGCGGTTATATCAAGGCGAAAGCAGTGGTCACCAAACGCATCCGTACCCTGGATGTGAATGGTCAGAAGGTGGATACCATCGGTATTCCGATTCACTGGGGCTTTGAGGGTGTGGCGGTGAAAGGCTTTATTACCAACACACTGACACCGTTTGTCGGGGATGCGAACACCCAGACGCCTGAATTTAAAGCCTTCCTGGTTAATGTGGAAAAGGTGTAAGGAGATAAATTATGTCAATGCAATCACAGGACATTATTCGTCGCTCTGCC