Homologs in group_1581

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10320 FBDBKF_10320 77.0 Morganella morganii S1 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
EHELCC_14655 EHELCC_14655 77.0 Morganella morganii S2 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
NLDBIP_14485 NLDBIP_14485 77.0 Morganella morganii S4 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
LHKJJB_14860 LHKJJB_14860 77.0 Morganella morganii S3 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
HKOGLL_13480 HKOGLL_13480 77.0 Morganella morganii S5 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
F4V73_RS14020 F4V73_RS14020 78.2 Morganella psychrotolerans rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ

Distribution of the homologs in the orthogroup group_1581

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1581

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F016 0.0 512 100 0 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Proteus mirabilis (strain HI4320)
Q7NA24 1.81e-140 396 79 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JSQ2 5.65e-136 385 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GL03 9.14e-135 382 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Serratia proteamaculans (strain 568)
B7LSX8 4.07e-133 378 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2VHE7 1.45e-132 377 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q31VC8 3.52e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella boydii serotype 4 (strain Sb227)
B2U3P9 3.52e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3YW34 3.84e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella sonnei (strain Ss046)
Q7UAV7 3.84e-132 375 75 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella flexneri
Q0SZG8 3.84e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella flexneri serotype 5b (strain 8401)
B7M2Q7 3.84e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O8 (strain IAI1)
B7L5X8 3.84e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain 55989 / EAEC)
A7ZT33 3.84e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O139:H28 (strain E24377A / ETEC)
B4TYZ1 4.04e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella schwarzengrund (strain CVM19633)
C0Q148 8.69e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi C (strain RKS4594)
Q57IN4 8.69e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella choleraesuis (strain SC-B67)
Q32AW6 9.24e-132 375 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella dysenteriae serotype 1 (strain Sd197)
Q8FCL1 1.23e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBW6 1.23e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AH34 1.23e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O1:K1 / APEC
B7N1D6 1.23e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O81 (strain ED1a)
B7MEJ2 1.23e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O45:K1 (strain S88 / ExPEC)
B6I359 1.3e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain SE11)
B1LIG5 1.4e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain SMS-3-5 / SECEC)
B7NEC8 1.4e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P68567 1.4e-131 374 75 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain K12)
B1J0D5 1.4e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5V4 1.4e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O9:H4 (strain HS)
B1X7V2 1.4e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain K12 / DH10B)
C4ZW44 1.4e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain K12 / MC4100 / BW2952)
B7NNB9 1.4e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YUS8 1.4e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O157:H7 (strain EC4115 / EHEC)
P68568 1.4e-131 374 75 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O157:H7
Q8Z270 1.41e-131 374 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella typhi
B5BHN9 1.42e-131 374 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi A (strain AKU_12601)
Q5PJN8 1.42e-131 374 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SWD9 1.42e-131 374 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella newport (strain SL254)
B5RGT3 1.42e-131 374 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3Z4 1.42e-131 374 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella enteritidis PT4 (strain P125109)
B5FKL3 1.42e-131 374 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella dublin (strain CT_02021853)
B5F9F6 1.42e-131 374 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella agona (strain SL483)
A9MLL7 1.84e-131 374 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9X6G2 3.27e-131 373 74 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T8C7 5.6e-131 373 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella heidelberg (strain SL476)
A9MU21 1.22e-130 372 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q664F4 1.27e-130 372 74 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQY1 1.27e-130 372 74 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis (strain Pestoides F)
Q1CDI1 1.27e-130 372 74 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZA46 1.27e-130 372 74 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis
B2K6K6 1.27e-130 372 74 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1A9 1.27e-130 372 74 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis bv. Antiqua (strain Antiqua)
A7FP06 1.27e-130 372 74 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JHU7 1.5e-130 372 75 0 246 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A8AR83 2.46e-130 371 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7UL45 2.73e-130 371 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1R5B9 3.75e-130 370 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain UTI89 / UPEC)
B5XN47 1e-129 369 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Klebsiella pneumoniae (strain 342)
A4WFT5 2.96e-129 369 73 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Enterobacter sp. (strain 638)
A6TFB5 6.12e-129 367 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MKM8 9.59e-129 367 73 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Cronobacter sakazakii (strain ATCC BAA-894)
Q6DB47 6.93e-128 365 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DJB2 9.84e-128 364 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7VNB5 1.46e-115 333 67 0 240 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LLM4 8.09e-114 329 64 1 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Photobacterium profundum (strain SS9)
Q5E8R9 7.92e-113 327 65 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aliivibrio fischeri (strain ATCC 700601 / ES114)
A3QJ65 6.12e-112 325 68 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q65PY5 8.37e-111 322 66 3 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CK31 2.82e-110 320 66 2 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pasteurella multocida (strain Pm70)
B0UVN8 6.82e-109 317 65 2 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Histophilus somni (strain 2336)
B3GZC5 4.56e-108 315 65 0 240 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3G7 4.56e-108 315 65 0 240 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0I1I8 5e-108 315 64 2 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Histophilus somni (strain 129Pt)
A8FPK4 7.78e-108 314 64 0 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sediminis (strain HAW-EB3)
B0BTF1 7.79e-108 314 65 0 240 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A7MU00 7.96e-108 314 63 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio campbellii (strain ATCC BAA-1116)
A1SBL0 1.35e-107 313 64 0 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B7VHB0 2.23e-107 313 62 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio atlanticus (strain LGP32)
B6EGR4 2.49e-107 313 66 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aliivibrio salmonicida (strain LFI1238)
B1KLA4 2.58e-107 313 65 1 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella woodyi (strain ATCC 51908 / MS32)
A5UDM5 3.19e-107 313 68 0 232 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain PittEE)
Q87TJ6 4.2e-107 312 62 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5UHZ6 5.44e-107 312 67 0 232 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain PittGG)
P44901 8.62e-107 311 68 0 232 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QM52 8.62e-107 311 68 0 232 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain 86-028NP)
Q8E8K6 1.02e-105 308 65 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C5BB22 9.41e-105 306 72 0 243 3 rsmJ Ribosomal RNA small subunit methyltransferase J Edwardsiella ictaluri (strain 93-146)
A8H9X0 9.77e-105 306 64 1 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q0HPQ7 1.16e-104 306 65 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain MR-7)
Q0HDH6 1.17e-104 306 65 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain MR-4)
B5FFB3 1.78e-104 306 65 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aliivibrio fischeri (strain MJ11)
A0L2I5 2.22e-104 306 65 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain ANA-3)
Q12I41 7.58e-104 304 65 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B0TN76 2.49e-103 303 64 2 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella halifaxensis (strain HAW-EB4)
B8CV40 3.05e-103 303 64 1 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella piezotolerans (strain WP3 / JCM 13877)
C3LPR5 8.35e-103 301 61 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio cholerae serotype O1 (strain M66-2)
Q9KVR6 8.35e-103 301 61 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A6VLG0 2.2e-102 300 62 3 254 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q07WD2 3.11e-102 301 65 2 235 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella frigidimarina (strain NCIMB 400)
A9KV34 5.76e-102 299 66 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella baltica (strain OS195)
A6WU68 7.09e-102 299 66 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella baltica (strain OS185)
B8ECV6 8.26e-102 299 66 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella baltica (strain OS223)
A1RQ25 2.09e-99 293 65 0 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain W3-18-1)
A4Y1K3 2.09e-99 293 65 0 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A4STK0 1.35e-96 285 64 0 213 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aeromonas salmonicida (strain A449)
Q8DD95 1.77e-96 285 62 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio vulnificus (strain CMCP6)
Q7MQD7 2.92e-96 285 62 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio vulnificus (strain YJ016)
Q3IIA6 5.13e-96 284 63 1 232 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudoalteromonas translucida (strain TAC 125)
A1SYH7 1.75e-95 283 55 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B8F6M3 6.61e-94 278 57 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Glaesserella parasuis serovar 5 (strain SH0165)
A0KEG6 1.3e-90 270 61 2 241 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C4LD58 7.45e-90 268 66 0 217 3 rsmJ Ribosomal RNA small subunit methyltransferase J Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q48AK7 2.68e-85 258 54 5 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q15Z03 6.51e-71 221 54 2 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8K904 1.08e-69 217 43 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D8E9 8.75e-69 215 45 0 233 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P57646 9.24e-69 214 44 0 233 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8A6 3.34e-68 213 44 0 233 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Q5QV55 5.43e-67 211 48 3 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B8GQ90 1.09e-65 207 54 3 206 3 rsmJ Ribosomal RNA small subunit methyltransferase J Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B3PLF9 7.15e-65 205 46 6 259 3 rsmJ Ribosomal RNA small subunit methyltransferase J Cellvibrio japonicus (strain Ueda107)
Q886R2 1.04e-64 205 52 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B4S2X7 9.43e-63 200 44 3 242 3 rsmJ Ribosomal RNA small subunit methyltransferase J Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q4ZWU6 1.46e-62 199 51 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas syringae pv. syringae (strain B728a)
Q48F42 1.6e-62 199 51 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q21HF7 1.94e-62 199 54 3 201 3 rsmJ Ribosomal RNA small subunit methyltransferase J Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q47IZ2 4.94e-62 197 53 2 195 3 rsmJ Ribosomal RNA small subunit methyltransferase J Dechloromonas aromatica (strain RCB)
Q83AK9 4.58e-61 195 48 2 221 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAW7 4.58e-61 195 48 2 221 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J3G6 4.58e-61 195 48 2 221 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain CbuG_Q212)
B6J489 4.58e-61 195 48 2 221 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain CbuK_Q154)
A9KB94 1.34e-60 194 48 2 221 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain Dugway 5J108-111)
Q88MQ7 1.39e-60 194 50 5 232 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3JC80 1.7e-60 194 49 4 217 3 rsmJ Ribosomal RNA small subunit methyltransferase J Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A5W873 1.86e-60 194 50 5 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1JBT2 9.77e-60 192 49 5 233 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain W619)
B0KS71 2.11e-59 191 50 4 223 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain GB-1)
Q9HXW0 6.18e-59 190 50 3 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V2T3 6.97e-59 190 50 3 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain LESB58)
Q02RF2 1.22e-58 189 50 3 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V1A8 1.73e-58 189 56 2 195 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain PA7)
C1DSX1 3.41e-58 188 49 2 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q3KHD6 2.9e-57 186 50 5 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas fluorescens (strain Pf0-1)
A4XXN9 4.11e-57 185 48 2 228 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas mendocina (strain ymp)
Q1IDU5 5.81e-57 185 54 4 196 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas entomophila (strain L48)
Q4KHJ7 9.05e-57 184 49 6 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q2SL17 1.3e-56 184 50 3 212 3 rsmJ Ribosomal RNA small subunit methyltransferase J Hahella chejuensis (strain KCTC 2396)
A4VN38 3.3e-56 183 49 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Stutzerimonas stutzeri (strain A1501)
A1U2T9 4.13e-55 181 48 3 207 3 rsmJ Ribosomal RNA small subunit methyltransferase J Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6VUQ9 7.98e-54 177 52 3 192 3 rsmJ Ribosomal RNA small subunit methyltransferase J Marinomonas sp. (strain MWYL1)
Q1QZ91 5.94e-53 174 47 3 238 3 rsmJ Ribosomal RNA small subunit methyltransferase J Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q31E43 8.55e-53 175 49 3 199 3 rsmJ Ribosomal RNA small subunit methyltransferase J Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
C3K4Q4 1.21e-52 174 46 6 241 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas fluorescens (strain SBW25)
Q6AL31 2.98e-52 173 46 1 191 3 rsmJ Ribosomal RNA small subunit methyltransferase J Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q8U8Q0 4.65e-49 163 44 4 204 3 rsmJ Ribosomal RNA small subunit methyltransferase J Agrobacterium fabrum (strain C58 / ATCC 33970)
C1DD01 2.15e-48 164 51 2 199 3 rsmJ Ribosomal RNA small subunit methyltransferase J Laribacter hongkongensis (strain HLHK9)
A1KV29 2.37e-47 160 49 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JTE9 5.2e-47 159 48 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M1A6 5.2e-47 159 48 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup C (strain 053442)
Q9JYF4 5.73e-47 159 48 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P72077 1.23e-46 158 48 4 194 1 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria gonorrhoeae
Q5F7B7 1.23e-46 158 48 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RIY4 1.74e-46 158 48 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria gonorrhoeae (strain NCCP11945)
A6WXR2 7.82e-44 149 42 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q5ZUG1 2.28e-41 144 40 10 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X479 3.25e-41 144 40 10 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila (strain Paris)
A5ICZ5 8.02e-41 143 40 10 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila (strain Corby)
A0L8U7 6.9e-40 141 38 1 213 3 rsmJ Ribosomal RNA small subunit methyltransferase J Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q5WVL3 9.36e-40 140 39 10 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila (strain Lens)
Q134B7 1.39e-38 137 40 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain BisB5)
Q7P0V2 2.49e-38 137 50 5 200 3 rsmJ Ribosomal RNA small subunit methyltransferase J Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B3QEZ3 3.56e-34 125 42 3 191 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain TIE-1)
Q2IYG1 1.16e-32 121 40 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain HaA2)
Q6N453 6.05e-32 119 42 3 191 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q0A6F5 9.69e-31 117 38 4 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q6MQB7 1.24e-29 114 38 5 213 3 rsmJ Ribosomal RNA small subunit methyltransferase J Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B0V7R3 1.65e-28 112 40 8 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain AYE)
B7I6D7 1.65e-28 112 40 8 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain AB0057)
B0VUQ6 2.57e-28 111 40 8 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain SDF)
A3M2K0 3.07e-28 111 40 8 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q6FEB3 3.94e-27 108 38 6 192 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1WYS6 7.01e-25 102 35 5 223 3 rsmJ Ribosomal RNA small subunit methyltransferase J Halorhodospira halophila (strain DSM 244 / SL1)
Q0VQG9 9.52e-25 101 39 4 195 3 rsmJ Ribosomal RNA small subunit methyltransferase J Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A5EWT6 9.9e-25 101 39 4 172 3 rsmJ Ribosomal RNA small subunit methyltransferase J Dichelobacter nodosus (strain VCS1703A)
B0TX95 7.11e-24 99 31 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B2HTX7 6.01e-22 94 39 8 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain ACICU)
A0Q814 1.62e-21 92 32 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. novicida (strain U112)
A4IXK7 5.08e-21 91 32 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NEV4 5.08e-21 91 32 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNN3 5.08e-21 91 32 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. holarctica (strain OSU18)
B2SEQ2 5.08e-21 91 32 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5B9 5.08e-21 91 32 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. holarctica (strain LVS)
A7N9Y1 5.08e-21 91 32 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14GA7 5.08e-21 91 32 3 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. tularensis (strain FSC 198)
Q4FR06 7.01e-16 78 31 8 207 3 rsmJ Ribosomal RNA small subunit methyltransferase J Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q994 1.26e-15 77 32 9 208 3 rsmJ Ribosomal RNA small subunit methyltransferase J Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14865
Feature type CDS
Gene rsmJ
Product 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
Location 3300031 - 3300777 (strand: 1)
Length 747 (nucleotides) / 248 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1581
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04445 Putative SAM-dependent methyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15984 16S rRNA (guanine1516-N2)-methyltransferase [EC:2.1.1.242] - -

Protein Sequence

MNICLLCEEGADNSALSALAQRWGLIHDATQTMALVLTPTHLELRKQDEPKLGGIYVDFVAGTMAHRRKFGGGRGEAVAKAVGIKKDYLPDVVDATAGLGRDAFVLASIGCNVRMVERHPVVAALLEDGLKRAYLDADIGEWMQQRMKLIYASSAQALTQISPTPDVVYLDPMYPHKTKSALVKKEMRVFQSLVGADEDADALLAPAMALAKKRVVVKRPDYAEPLNNQPAHASVTTKNHRFDIYPCI

Flanking regions ( +/- flanking 50bp)

AGCCGAAACTTGATGCTATGCTCAAAGGCTACGGCATTAAAGGATGATATGTGAATATCTGTTTACTTTGTGAAGAAGGCGCTGATAACAGCGCCTTATCTGCTTTAGCGCAACGTTGGGGATTAATTCACGACGCCACACAAACTATGGCGTTAGTCTTAACGCCCACTCACCTTGAATTGCGTAAACAAGATGAGCCTAAACTTGGTGGGATCTACGTGGATTTTGTCGCGGGTACTATGGCTCATCGTCGTAAATTTGGCGGTGGTCGTGGTGAAGCGGTAGCAAAAGCAGTAGGTATTAAAAAGGATTATCTACCCGATGTGGTTGATGCAACAGCAGGATTAGGCCGTGATGCCTTTGTATTAGCCTCTATTGGTTGTAACGTAAGAATGGTTGAACGTCATCCTGTGGTGGCTGCATTACTTGAAGATGGCTTGAAACGCGCTTATCTCGATGCAGATATTGGTGAGTGGATGCAACAGCGTATGAAGCTCATTTATGCTTCATCTGCACAGGCACTCACGCAAATTAGCCCTACACCTGATGTAGTCTATCTTGATCCTATGTATCCCCATAAAACCAAAAGCGCATTAGTGAAAAAAGAGATGCGGGTATTCCAATCTCTTGTCGGTGCGGATGAAGATGCTGATGCATTATTAGCACCAGCCATGGCACTGGCTAAAAAACGAGTGGTTGTTAAGCGTCCTGATTATGCTGAGCCGTTAAATAATCAACCCGCACATGCAAGTGTCACCACCAAAAATCACCGTTTTGATATCTATCCTTGTATCTAGCCATAGATAACCCATAGAGGGGCGTGTCTCCCCCTCTTTTCCCGTAACTT