Homologs in group_1629

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10320 FBDBKF_10320 100.0 Morganella morganii S1 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
EHELCC_14655 EHELCC_14655 100.0 Morganella morganii S2 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
LHKJJB_14860 LHKJJB_14860 100.0 Morganella morganii S3 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
HKOGLL_13480 HKOGLL_13480 100.0 Morganella morganii S5 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
F4V73_RS14020 F4V73_RS14020 89.7 Morganella psychrotolerans rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
PMI_RS14865 PMI_RS14865 77.0 Proteus mirabilis HI4320 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ

Distribution of the homologs in the orthogroup group_1629

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1629

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7NA24 1.74e-137 389 82 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JSQ2 6.48e-131 373 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4F016 7.71e-130 370 77 0 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Proteus mirabilis (strain HI4320)
A8GL03 5.01e-128 365 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Serratia proteamaculans (strain 568)
B7LSX8 1.19e-127 364 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2VHE7 2.43e-127 363 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q31VC8 3.03e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella boydii serotype 4 (strain Sb227)
B2U3P9 3.03e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q8FCL1 3.24e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBW6 3.24e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AH34 3.24e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O1:K1 / APEC
B7N1D6 3.24e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O81 (strain ED1a)
B7MEJ2 3.24e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3YW34 5.6e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella sonnei (strain Ss046)
Q7UAV7 5.6e-127 363 76 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella flexneri
Q0SZG8 5.6e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella flexneri serotype 5b (strain 8401)
B7M2Q7 5.6e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O8 (strain IAI1)
B7L5X8 5.6e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain 55989 / EAEC)
A7ZT33 5.6e-127 363 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O139:H28 (strain E24377A / ETEC)
B5XN47 5.91e-127 362 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Klebsiella pneumoniae (strain 342)
B1LIG5 1.34e-126 362 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain SMS-3-5 / SECEC)
B7NEC8 1.34e-126 362 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P68567 1.34e-126 362 75 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain K12)
B1J0D5 1.34e-126 362 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5V4 1.34e-126 362 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O9:H4 (strain HS)
B1X7V2 1.34e-126 362 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain K12 / DH10B)
C4ZW44 1.34e-126 362 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain K12 / MC4100 / BW2952)
B7NNB9 1.34e-126 362 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YUS8 1.34e-126 362 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O157:H7 (strain EC4115 / EHEC)
P68568 1.34e-126 362 75 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O157:H7
B7UL45 1.65e-126 362 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4WFT5 2.82e-126 361 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Enterobacter sp. (strain 638)
B6I359 4.15e-126 360 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain SE11)
Q664F4 5.47e-126 360 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQY1 5.47e-126 360 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis (strain Pestoides F)
Q1CDI1 5.47e-126 360 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZA46 5.47e-126 360 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis
B2K6K6 5.47e-126 360 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1A9 5.47e-126 360 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis bv. Antiqua (strain Antiqua)
A7FP06 5.47e-126 360 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8Z270 1.12e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella typhi
B1JHU7 1.19e-125 360 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B5BHN9 1.22e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi A (strain AKU_12601)
Q5PJN8 1.22e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SWD9 1.22e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella newport (strain SL254)
B5RGT3 1.22e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3Z4 1.22e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella enteritidis PT4 (strain P125109)
B5FKL3 1.22e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella dublin (strain CT_02021853)
B5F9F6 1.22e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella agona (strain SL483)
A9MU21 1.38e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q1R5B9 1.53e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain UTI89 / UPEC)
A6TFB5 1.58e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C0Q148 2e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi C (strain RKS4594)
Q57IN4 2e-125 359 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella choleraesuis (strain SC-B67)
Q9X6G2 2.02e-125 359 75 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q32AW6 4.19e-125 358 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella dysenteriae serotype 1 (strain Sd197)
B4T8C7 4.39e-125 358 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella heidelberg (strain SL476)
A8AR83 8.2e-125 357 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MLL7 3.65e-124 355 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4TYZ1 5.11e-124 355 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella schwarzengrund (strain CVM19633)
C6DJB2 1.63e-123 354 77 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6DB47 6.91e-122 350 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MKM8 5.87e-121 347 73 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Cronobacter sakazakii (strain ATCC BAA-894)
Q6LLM4 6.83e-115 332 66 1 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Photobacterium profundum (strain SS9)
Q87TJ6 7.75e-113 327 67 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MU00 9.81e-112 324 66 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio campbellii (strain ATCC BAA-1116)
B7VHB0 3.03e-111 323 64 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio atlanticus (strain LGP32)
Q5E8R9 8.94e-111 322 64 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7VNB5 1.08e-109 319 64 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A3QJ65 1.45e-108 316 67 0 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1SBL0 5.49e-107 312 67 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8H9X0 3.75e-106 310 67 1 228 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B3GZC5 4.92e-106 310 64 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3G7 4.92e-106 310 64 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C3LPR5 7.23e-106 310 62 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio cholerae serotype O1 (strain M66-2)
Q9KVR6 7.23e-106 310 62 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A8FPK4 8.12e-106 309 65 0 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sediminis (strain HAW-EB3)
B1KLA4 8.16e-106 310 68 1 228 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella woodyi (strain ATCC 51908 / MS32)
B0BTF1 1.35e-105 308 64 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q8E8K6 2.32e-105 308 66 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C5BB22 2.45e-105 308 74 0 243 3 rsmJ Ribosomal RNA small subunit methyltransferase J Edwardsiella ictaluri (strain 93-146)
Q0HDH6 4.84e-105 307 67 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain MR-4)
Q0HPQ7 7.26e-105 307 67 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain MR-7)
A5UDM5 7.71e-105 307 64 1 244 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain PittEE)
A0L2I5 1.65e-104 306 67 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain ANA-3)
B8CV40 2.07e-104 306 65 1 235 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella piezotolerans (strain WP3 / JCM 13877)
B0TN76 2.67e-104 305 67 1 228 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella halifaxensis (strain HAW-EB4)
Q12I41 7.25e-104 304 66 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B6EGR4 9.06e-104 304 64 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aliivibrio salmonicida (strain LFI1238)
P44901 1.06e-103 304 63 1 244 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QM52 1.23e-103 304 63 1 244 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain 86-028NP)
Q65PY5 1.23e-103 303 63 2 249 3 rsmJ Ribosomal RNA small subunit methyltransferase J Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A5UHZ6 1.35e-103 304 63 1 244 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain PittGG)
B5FFB3 5.68e-103 302 64 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aliivibrio fischeri (strain MJ11)
B0UVN8 3.39e-102 300 62 3 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Histophilus somni (strain 2336)
Q9CK31 7.68e-102 299 64 2 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pasteurella multocida (strain Pm70)
Q8DD95 7.74e-102 299 66 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio vulnificus (strain CMCP6)
Q7MQD7 8.36e-102 299 66 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio vulnificus (strain YJ016)
Q0I1I8 1.37e-101 298 62 3 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Histophilus somni (strain 129Pt)
Q07WD2 1.06e-100 297 65 1 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella frigidimarina (strain NCIMB 400)
A9KV34 2.73e-100 295 68 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella baltica (strain OS195)
A6WU68 3.43e-100 295 68 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella baltica (strain OS185)
B8ECV6 6.4e-100 294 68 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella baltica (strain OS223)
A1RQ25 1.35e-98 291 67 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain W3-18-1)
A4Y1K3 1.35e-98 291 67 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A4STK0 6.92e-97 286 60 1 243 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aeromonas salmonicida (strain A449)
A6VLG0 1.13e-95 283 62 3 254 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8F6M3 2e-95 283 57 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Glaesserella parasuis serovar 5 (strain SH0165)
Q3IIA6 2.33e-92 275 62 1 232 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudoalteromonas translucida (strain TAC 125)
A0KEG6 2.23e-89 267 61 1 243 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C4LD58 5.01e-89 266 68 0 213 3 rsmJ Ribosomal RNA small subunit methyltransferase J Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q48AK7 3.07e-85 258 62 2 211 3 rsmJ Ribosomal RNA small subunit methyltransferase J Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1SYH7 4.9e-82 249 54 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8K904 3.82e-71 221 44 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q15Z03 4.81e-71 221 56 3 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P57646 1.24e-70 219 44 2 246 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8E9 1.51e-70 219 45 2 246 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q5QV55 3.31e-70 219 49 3 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B8D8A6 4.74e-70 218 44 2 246 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8GQ90 1.32e-67 212 55 2 215 3 rsmJ Ribosomal RNA small subunit methyltransferase J Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q886R2 3.05e-67 212 55 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZWU6 4.55e-67 211 55 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas syringae pv. syringae (strain B728a)
Q48F42 9.74e-67 210 51 3 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B4S2X7 3.87e-66 209 47 5 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0KS71 1.03e-65 207 54 2 221 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain GB-1)
A5W873 1.2e-65 207 54 3 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q47IZ2 2.48e-65 206 53 2 215 3 rsmJ Ribosomal RNA small subunit methyltransferase J Dechloromonas aromatica (strain RCB)
B1JBT2 6.8e-65 205 50 3 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain W619)
Q88MQ7 1.29e-64 204 53 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A4XXN9 3.89e-64 203 50 2 251 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas mendocina (strain ymp)
C1DSX1 8.71e-64 202 53 2 232 3 rsmJ Ribosomal RNA small subunit methyltransferase J Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4KHJ7 1.53e-63 202 48 3 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1IDU5 2.49e-63 201 54 2 220 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas entomophila (strain L48)
B3PLF9 1.07e-62 200 51 3 220 3 rsmJ Ribosomal RNA small subunit methyltransferase J Cellvibrio japonicus (strain Ueda107)
Q3JC80 2.24e-62 199 53 4 216 3 rsmJ Ribosomal RNA small subunit methyltransferase J Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q02RF2 5.07e-62 198 50 4 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V2T3 1.12e-61 197 49 4 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain LESB58)
Q9HXW0 1.35e-61 197 49 4 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3KHD6 2.73e-61 196 52 2 215 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas fluorescens (strain Pf0-1)
A6V1A8 6.85e-61 195 52 2 223 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain PA7)
Q21HF7 3.33e-60 194 48 2 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4VN38 4.7e-60 193 51 3 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Stutzerimonas stutzeri (strain A1501)
A1U2T9 1.8e-58 189 49 3 216 3 rsmJ Ribosomal RNA small subunit methyltransferase J Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C3K4Q4 2.58e-58 189 52 2 215 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas fluorescens (strain SBW25)
Q83AK9 4.16e-57 185 48 2 222 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAW7 4.16e-57 185 48 2 222 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J3G6 4.16e-57 185 48 2 222 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain CbuG_Q212)
B6J489 4.16e-57 185 48 2 222 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain CbuK_Q154)
A9KB94 1.68e-56 184 48 2 222 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain Dugway 5J108-111)
Q2SL17 1.32e-54 179 46 4 239 3 rsmJ Ribosomal RNA small subunit methyltransferase J Hahella chejuensis (strain KCTC 2396)
Q1QZ91 4.5e-53 175 51 3 235 3 rsmJ Ribosomal RNA small subunit methyltransferase J Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A6VUQ9 4.16e-51 170 46 2 236 3 rsmJ Ribosomal RNA small subunit methyltransferase J Marinomonas sp. (strain MWYL1)
Q8U8Q0 6.2e-50 166 48 2 190 3 rsmJ Ribosomal RNA small subunit methyltransferase J Agrobacterium fabrum (strain C58 / ATCC 33970)
Q31E43 6.24e-50 167 48 3 199 3 rsmJ Ribosomal RNA small subunit methyltransferase J Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q6AL31 6.49e-49 164 46 1 191 3 rsmJ Ribosomal RNA small subunit methyltransferase J Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q9JYF4 1.43e-45 155 49 4 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KV29 2.56e-45 155 49 4 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
C1DD01 2.97e-45 155 52 2 199 3 rsmJ Ribosomal RNA small subunit methyltransferase J Laribacter hongkongensis (strain HLHK9)
Q9JTE9 3.21e-45 155 49 4 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M1A6 3.21e-45 155 49 4 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup C (strain 053442)
B4RIY4 7.6e-45 154 48 4 197 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria gonorrhoeae (strain NCCP11945)
P72077 9.95e-45 153 48 4 197 1 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria gonorrhoeae
Q5F7B7 9.95e-45 153 48 4 197 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A6WXR2 1.16e-44 152 49 5 199 3 rsmJ Ribosomal RNA small subunit methyltransferase J Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q7P0V2 3.49e-41 144 50 5 215 3 rsmJ Ribosomal RNA small subunit methyltransferase J Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q134B7 8.72e-41 142 46 3 191 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain BisB5)
A0L8U7 2.29e-38 137 38 1 205 3 rsmJ Ribosomal RNA small subunit methyltransferase J Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q5WVL3 1.31e-37 135 39 7 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila (strain Lens)
A5ICZ5 2.12e-37 134 39 7 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila (strain Corby)
Q5X479 4.39e-37 134 39 7 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila (strain Paris)
Q5ZUG1 4.99e-37 133 39 7 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q2IYG1 2.01e-36 131 45 2 190 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain HaA2)
B3QEZ3 2.01e-34 125 45 2 190 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain TIE-1)
Q0A6F5 4.93e-34 126 41 3 226 3 rsmJ Ribosomal RNA small subunit methyltransferase J Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q6N453 6.27e-32 119 45 2 190 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q6MQB7 2.47e-29 114 35 5 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q6FEB3 1.96e-26 106 38 6 192 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0VUQ6 2.52e-26 106 38 6 185 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain SDF)
B0V7R3 1.56e-25 104 37 6 185 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain AYE)
B7I6D7 1.56e-25 104 37 6 185 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain AB0057)
A3M2K0 1.59e-25 104 37 6 185 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q0VQG9 2.9e-25 103 40 4 199 3 rsmJ Ribosomal RNA small subunit methyltransferase J Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A0Q814 2.19e-24 100 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. novicida (strain U112)
A5EWT6 3.25e-24 100 37 3 172 3 rsmJ Ribosomal RNA small subunit methyltransferase J Dichelobacter nodosus (strain VCS1703A)
A4IXK7 7.99e-24 99 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NEV4 7.99e-24 99 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNN3 7.99e-24 99 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. holarctica (strain OSU18)
B2SEQ2 7.99e-24 99 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5B9 7.99e-24 99 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. holarctica (strain LVS)
A7N9Y1 7.99e-24 99 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14GA7 7.99e-24 99 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. tularensis (strain FSC 198)
B0TX95 9.45e-24 99 31 3 191 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A1WYS6 1.9e-22 95 39 7 204 3 rsmJ Ribosomal RNA small subunit methyltransferase J Halorhodospira halophila (strain DSM 244 / SL1)
B2HTX7 1.36e-20 91 37 5 184 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain ACICU)
Q4FR06 4.68e-19 87 34 7 206 3 rsmJ Ribosomal RNA small subunit methyltransferase J Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q994 1.6e-17 83 31 8 206 3 rsmJ Ribosomal RNA small subunit methyltransferase J Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_14485
Feature type CDS
Gene rsmJ
Product 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
Location 18016 - 18774 (strand: 1)
Length 759 (nucleotides) / 252 (amino acids)
In genomic island -

Contig

Accession ZDB_530
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1629
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04445 Putative SAM-dependent methyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15984 16S rRNA (guanine1516-N2)-methyltransferase [EC:2.1.1.242] - -

Protein Sequence

MKIRLQCEQGADSCALDVLAARWGLEHDDTALMALVLTAEGLELRKCDEPKLGGIRVDFAGGTMAHRRRFGGGRGEAVAKAAGIKKSYLPSVVDATAGLGRDAFVLASLGCHVRMIERHPVVAALLDDGLQRAYRDSEIGGWMQERMILIHASGIDALADITPPPDVVYLDPMYPHRQKSALVKKEMRVFQSLVGADEDADLLLAPALALATRRVVVKRPDYAEPLAGQKAAAAIETKNHRFDIYPCVKAEG

Flanking regions ( +/- flanking 50bp)

AGCCGGAACTGGATGCGATGTTAAAAGGCTACGGAATCAACGGGTAATACGTGAAGATTCGTTTACAGTGTGAACAGGGCGCAGACAGCTGCGCCCTTGATGTATTGGCGGCGCGGTGGGGCCTGGAGCATGATGATACCGCGCTGATGGCGCTGGTGCTGACGGCGGAAGGGCTGGAACTGCGCAAGTGTGATGAACCGAAACTCGGCGGGATCCGTGTGGATTTTGCCGGGGGAACGATGGCACACCGGCGCCGTTTCGGCGGCGGACGCGGTGAAGCAGTGGCAAAGGCTGCCGGGATTAAGAAATCCTATCTTCCGTCAGTGGTGGACGCGACAGCCGGTCTCGGGCGTGATGCCTTTGTGCTGGCATCGCTGGGCTGTCATGTGCGGATGATTGAACGCCATCCGGTCGTTGCGGCACTGCTGGATGATGGCTTACAGCGGGCCTACCGGGACAGTGAAATCGGGGGATGGATGCAGGAGAGAATGATCCTTATCCATGCGTCCGGGATTGATGCGCTGGCGGACATCACACCGCCGCCGGATGTGGTCTATCTCGACCCGATGTATCCGCACCGGCAGAAAAGCGCGCTGGTGAAGAAAGAAATGCGGGTGTTTCAGTCGCTGGTGGGTGCGGATGAGGATGCGGATCTTCTGCTGGCACCTGCACTGGCGCTGGCAACCCGTCGTGTGGTGGTGAAACGTCCGGATTATGCGGAGCCGTTAGCCGGGCAGAAAGCGGCTGCGGCGATTGAAACCAAAAACCATCGTTTTGATATCTATCCCTGTGTGAAAGCAGAGGGATAACACTGAATAACATCTGAAAAGGGGACAGGGCAGTTCCCGTTTCGCGAAGG