Homologs in group_1629

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10320 FBDBKF_10320 89.7 Morganella morganii S1 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
EHELCC_14655 EHELCC_14655 89.7 Morganella morganii S2 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
NLDBIP_14485 NLDBIP_14485 89.7 Morganella morganii S4 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
LHKJJB_14860 LHKJJB_14860 89.7 Morganella morganii S3 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
HKOGLL_13480 HKOGLL_13480 89.7 Morganella morganii S5 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
PMI_RS14865 PMI_RS14865 78.2 Proteus mirabilis HI4320 rsmJ 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ

Distribution of the homologs in the orthogroup group_1629

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1629

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7NA24 1.4e-136 387 80 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JSQ2 7.83e-134 380 77 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4F016 1.31e-133 379 78 0 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Proteus mirabilis (strain HI4320)
A8GL03 6.7e-132 375 77 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Serratia proteamaculans (strain 568)
B2VHE7 2.25e-131 374 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q8Z270 9e-128 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella typhi
B5BHN9 9.3e-128 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi A (strain AKU_12601)
Q5PJN8 9.3e-128 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SWD9 9.3e-128 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella newport (strain SL254)
B5RGT3 9.3e-128 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3Z4 9.3e-128 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella enteritidis PT4 (strain P125109)
B5FKL3 9.3e-128 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella dublin (strain CT_02021853)
B5F9F6 9.3e-128 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella agona (strain SL483)
A9MU21 9.93e-128 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
C0Q148 1.17e-127 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella paratyphi C (strain RKS4594)
Q57IN4 1.17e-127 365 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella choleraesuis (strain SC-B67)
Q9X6G2 1.51e-127 364 74 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T8C7 2.94e-127 363 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella heidelberg (strain SL476)
B4TYZ1 3.58e-127 363 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella schwarzengrund (strain CVM19633)
B7LSX8 5.7e-127 363 75 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8FCL1 2.27e-126 361 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBW6 2.27e-126 361 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AH34 2.27e-126 361 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O1:K1 / APEC
B7N1D6 2.27e-126 361 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O81 (strain ED1a)
B7MEJ2 2.27e-126 361 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O45:K1 (strain S88 / ExPEC)
Q31VC8 2.37e-126 361 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella boydii serotype 4 (strain Sb227)
B2U3P9 2.37e-126 361 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q664F4 2.43e-126 361 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQY1 2.43e-126 361 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis (strain Pestoides F)
Q1CDI1 2.43e-126 361 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZA46 2.43e-126 361 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis
B2K6K6 2.43e-126 361 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1A9 2.43e-126 361 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pestis bv. Antiqua (strain Antiqua)
A7FP06 2.43e-126 361 76 0 247 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3YW34 3.83e-126 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella sonnei (strain Ss046)
Q7UAV7 3.83e-126 360 74 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella flexneri
Q0SZG8 3.83e-126 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella flexneri serotype 5b (strain 8401)
B7M2Q7 3.83e-126 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O8 (strain IAI1)
B7L5X8 3.83e-126 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain 55989 / EAEC)
A7ZT33 3.83e-126 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O139:H28 (strain E24377A / ETEC)
B1JHU7 4.24e-126 361 76 0 246 3 rsmJ Ribosomal RNA small subunit methyltransferase J Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A9MLL7 9.08e-126 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B6I359 9.31e-126 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain SE11)
B1LIG5 1.04e-125 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain SMS-3-5 / SECEC)
B7NEC8 1.04e-125 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P68567 1.04e-125 360 74 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain K12)
B1J0D5 1.04e-125 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5V4 1.04e-125 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O9:H4 (strain HS)
B1X7V2 1.04e-125 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain K12 / DH10B)
C4ZW44 1.04e-125 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain K12 / MC4100 / BW2952)
B7NNB9 1.04e-125 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YUS8 1.04e-125 360 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O157:H7 (strain EC4115 / EHEC)
P68568 1.04e-125 360 74 0 245 1 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O157:H7
A8AR83 1.67e-125 359 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7UL45 2.07e-125 359 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32AW6 2.16e-125 359 73 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shigella dysenteriae serotype 1 (strain Sd197)
A4WFT5 5.01e-125 358 73 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Enterobacter sp. (strain 638)
Q1R5B9 1.18e-124 357 74 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Escherichia coli (strain UTI89 / UPEC)
A6TFB5 2.35e-124 356 73 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XN47 7.03e-124 355 73 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Klebsiella pneumoniae (strain 342)
C6DJB2 4.76e-123 353 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MKM8 9.53e-123 352 73 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Cronobacter sakazakii (strain ATCC BAA-894)
Q6DB47 9.7e-123 352 76 0 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6LLM4 3.11e-112 326 65 1 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Photobacterium profundum (strain SS9)
Q87TJ6 3.71e-111 323 64 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C5BB22 5.6e-111 322 76 0 243 3 rsmJ Ribosomal RNA small subunit methyltransferase J Edwardsiella ictaluri (strain 93-146)
B7VHB0 6e-111 322 64 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio atlanticus (strain LGP32)
Q5E8R9 8.06e-111 322 65 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7VNB5 1.01e-110 322 63 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A7MU00 1.02e-109 319 63 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio campbellii (strain ATCC BAA-1116)
A3QJ65 1.14e-108 317 65 1 241 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A5UDM5 1.57e-108 316 67 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain PittEE)
B1KLA4 6.46e-108 315 68 1 228 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella woodyi (strain ATCC 51908 / MS32)
Q0HDH6 7.04e-108 315 67 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain MR-4)
Q0HPQ7 1.2e-107 314 67 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain MR-7)
A0L2I5 2.24e-107 313 67 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain ANA-3)
A8FPK4 2.31e-107 313 66 0 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sediminis (strain HAW-EB3)
A5UHZ6 2.84e-107 313 66 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain PittGG)
P44901 4.7e-107 313 66 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QM52 5.59e-107 312 66 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Haemophilus influenzae (strain 86-028NP)
Q8E8K6 9.56e-107 311 66 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B3GZC5 1.3e-106 311 63 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3G7 1.3e-106 311 63 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1SBL0 2.44e-106 310 65 0 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B0BTF1 2.48e-106 310 63 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B8CV40 3.38e-106 311 65 1 235 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H9X0 3.98e-106 310 66 1 228 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
C3LPR5 1.25e-105 309 62 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio cholerae serotype O1 (strain M66-2)
Q9KVR6 1.25e-105 309 62 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B0TN76 1.07e-104 306 66 1 228 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella halifaxensis (strain HAW-EB4)
B6EGR4 7.9e-104 305 64 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aliivibrio salmonicida (strain LFI1238)
Q12I41 8.68e-104 304 66 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q9CK31 9.21e-104 304 64 2 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pasteurella multocida (strain Pm70)
Q07WD2 1.16e-103 305 65 1 235 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella frigidimarina (strain NCIMB 400)
B5FFB3 2.46e-103 303 65 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aliivibrio fischeri (strain MJ11)
Q65PY5 7.2e-103 302 63 3 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A9KV34 3.46e-102 300 68 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella baltica (strain OS195)
A6WU68 3.86e-102 300 68 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella baltica (strain OS185)
B8ECV6 7.11e-102 299 68 0 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella baltica (strain OS223)
B0UVN8 1.74e-101 298 61 3 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Histophilus somni (strain 2336)
A1RQ25 2.37e-101 298 66 0 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella sp. (strain W3-18-1)
A4Y1K3 2.37e-101 298 66 0 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q0I1I8 7.35e-101 297 61 3 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Histophilus somni (strain 129Pt)
Q7MQD7 7.97e-101 297 65 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio vulnificus (strain YJ016)
Q8DD95 9.29e-101 296 65 2 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Vibrio vulnificus (strain CMCP6)
A6VLG0 6.56e-100 295 62 3 254 3 rsmJ Ribosomal RNA small subunit methyltransferase J Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A4STK0 1.73e-97 288 67 0 213 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aeromonas salmonicida (strain A449)
B8F6M3 1.25e-95 283 57 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Glaesserella parasuis serovar 5 (strain SH0165)
Q3IIA6 8.33e-95 281 62 3 233 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudoalteromonas translucida (strain TAC 125)
C4LD58 8.37e-91 271 68 0 215 3 rsmJ Ribosomal RNA small subunit methyltransferase J Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A0KEG6 5.08e-88 264 61 1 243 3 rsmJ Ribosomal RNA small subunit methyltransferase J Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q48AK7 6.39e-86 259 55 4 253 3 rsmJ Ribosomal RNA small subunit methyltransferase J Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1SYH7 4.41e-85 257 54 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q15Z03 2.87e-72 224 56 2 234 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8K904 5.01e-71 221 42 1 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q4ZWU6 3.61e-70 219 56 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas syringae pv. syringae (strain B728a)
Q886R2 1.26e-69 218 55 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48F42 2.97e-69 217 55 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P57646 1.03e-68 215 45 0 223 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8E9 1.3e-68 214 45 0 223 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D8A6 6.45e-68 213 45 0 223 3 rsmJ Ribosomal RNA small subunit methyltransferase J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8GQ90 1.24e-67 212 54 2 216 3 rsmJ Ribosomal RNA small subunit methyltransferase J Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B0KS71 1.39e-67 212 55 2 222 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain GB-1)
Q47IZ2 8.22e-67 210 56 2 208 3 rsmJ Ribosomal RNA small subunit methyltransferase J Dechloromonas aromatica (strain RCB)
Q5QV55 1e-66 210 49 3 243 3 rsmJ Ribosomal RNA small subunit methyltransferase J Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B4S2X7 1.99e-66 209 47 5 245 3 rsmJ Ribosomal RNA small subunit methyltransferase J Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B1JBT2 2.31e-66 209 51 3 248 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain W619)
Q88MQ7 7.8e-66 208 54 3 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W873 1.02e-65 207 54 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4KHJ7 5.79e-65 206 52 3 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B3PLF9 1.16e-64 205 53 3 220 3 rsmJ Ribosomal RNA small subunit methyltransferase J Cellvibrio japonicus (strain Ueda107)
A4XXN9 1.81e-64 204 50 2 252 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas mendocina (strain ymp)
C1DSX1 1.94e-64 204 52 2 244 3 rsmJ Ribosomal RNA small subunit methyltransferase J Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1IDU5 1.91e-63 202 54 3 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas entomophila (strain L48)
Q3KHD6 5.9e-63 201 53 2 215 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas fluorescens (strain Pf0-1)
Q02RF2 1.27e-62 200 50 4 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain UCBPP-PA14)
Q21HF7 1.6e-62 200 52 3 221 3 rsmJ Ribosomal RNA small subunit methyltransferase J Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9HXW0 1.92e-62 199 50 4 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V2T3 3.53e-62 199 50 4 250 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain LESB58)
A4VN38 6.18e-62 198 52 3 235 3 rsmJ Ribosomal RNA small subunit methyltransferase J Stutzerimonas stutzeri (strain A1501)
A6V1A8 2.3e-61 196 52 2 223 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas aeruginosa (strain PA7)
C3K4Q4 2.15e-60 194 49 5 249 3 rsmJ Ribosomal RNA small subunit methyltransferase J Pseudomonas fluorescens (strain SBW25)
Q3JC80 2.63e-60 194 51 4 216 3 rsmJ Ribosomal RNA small subunit methyltransferase J Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q83AK9 1.93e-59 191 51 3 212 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAW7 1.93e-59 191 51 3 212 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J3G6 1.93e-59 191 51 3 212 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain CbuG_Q212)
B6J489 1.93e-59 191 51 3 212 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain CbuK_Q154)
A1U2T9 5.74e-59 191 49 3 216 3 rsmJ Ribosomal RNA small subunit methyltransferase J Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A9KB94 7.99e-59 190 51 3 212 3 rsmJ Ribosomal RNA small subunit methyltransferase J Coxiella burnetii (strain Dugway 5J108-111)
Q1QZ91 1.7e-55 181 51 2 231 3 rsmJ Ribosomal RNA small subunit methyltransferase J Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2SL17 9.76e-53 174 49 3 205 3 rsmJ Ribosomal RNA small subunit methyltransferase J Hahella chejuensis (strain KCTC 2396)
Q6AL31 4.37e-52 173 44 3 222 3 rsmJ Ribosomal RNA small subunit methyltransferase J Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A6VUQ9 3.08e-51 171 49 2 212 3 rsmJ Ribosomal RNA small subunit methyltransferase J Marinomonas sp. (strain MWYL1)
Q8U8Q0 2.24e-50 167 46 2 200 3 rsmJ Ribosomal RNA small subunit methyltransferase J Agrobacterium fabrum (strain C58 / ATCC 33970)
Q31E43 1.23e-48 164 47 3 203 3 rsmJ Ribosomal RNA small subunit methyltransferase J Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
C1DD01 3.33e-47 161 52 2 199 3 rsmJ Ribosomal RNA small subunit methyltransferase J Laribacter hongkongensis (strain HLHK9)
A6WXR2 3.08e-46 156 47 2 190 3 rsmJ Ribosomal RNA small subunit methyltransferase J Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A0L8U7 8.41e-45 154 39 2 227 3 rsmJ Ribosomal RNA small subunit methyltransferase J Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q9JYF4 8.62e-45 154 49 4 193 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KV29 1.56e-44 153 51 6 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JTE9 1.59e-44 153 51 6 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M1A6 1.59e-44 153 51 6 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria meningitidis serogroup C (strain 053442)
P72077 2.08e-43 150 49 6 197 1 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria gonorrhoeae
Q5F7B7 2.08e-43 150 49 6 197 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RIY4 2.29e-43 150 49 6 197 3 rsmJ Ribosomal RNA small subunit methyltransferase J Neisseria gonorrhoeae (strain NCCP11945)
Q134B7 8.86e-42 145 43 2 198 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain BisB5)
Q7P0V2 1.13e-41 146 50 6 222 3 rsmJ Ribosomal RNA small subunit methyltransferase J Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A5ICZ5 1.72e-38 137 39 6 230 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila (strain Corby)
Q5ZUG1 3.92e-38 136 38 6 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X479 4e-38 136 38 6 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila (strain Paris)
Q2IYG1 2.9e-37 133 44 2 190 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain HaA2)
Q5WVL3 3.33e-37 134 38 6 229 3 rsmJ Ribosomal RNA small subunit methyltransferase J Legionella pneumophila (strain Lens)
Q0A6F5 7.28e-35 128 42 3 223 3 rsmJ Ribosomal RNA small subunit methyltransferase J Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B3QEZ3 1.02e-33 124 44 2 190 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain TIE-1)
Q6N453 8.33e-32 119 42 2 190 3 rsmJ Ribosomal RNA small subunit methyltransferase J Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q6MQB7 5.49e-29 113 36 7 219 3 rsmJ Ribosomal RNA small subunit methyltransferase J Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q0VQG9 1.12e-26 107 40 4 199 3 rsmJ Ribosomal RNA small subunit methyltransferase J Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B0TX95 5.66e-25 102 31 3 191 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A3M2K0 1.26e-24 102 36 6 185 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0V7R3 1.33e-24 102 36 6 185 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain AYE)
B7I6D7 1.33e-24 102 36 6 185 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain AB0057)
Q6FEB3 1.83e-24 101 35 6 192 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0VUQ6 1.84e-24 101 36 6 185 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain SDF)
A1WYS6 3.47e-24 100 41 8 204 3 rsmJ Ribosomal RNA small subunit methyltransferase J Halorhodospira halophila (strain DSM 244 / SL1)
A0Q814 9.24e-24 99 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. novicida (strain U112)
A4IXK7 4.37e-23 97 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NEV4 4.37e-23 97 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNN3 4.37e-23 97 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. holarctica (strain OSU18)
B2SEQ2 4.37e-23 97 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5B9 4.37e-23 97 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. holarctica (strain LVS)
A7N9Y1 4.37e-23 97 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14GA7 4.37e-23 97 32 4 194 3 rsmJ Ribosomal RNA small subunit methyltransferase J Francisella tularensis subsp. tularensis (strain FSC 198)
A5EWT6 2.55e-22 95 35 9 218 3 rsmJ Ribosomal RNA small subunit methyltransferase J Dichelobacter nodosus (strain VCS1703A)
B2HTX7 8.88e-19 86 35 5 184 3 rsmJ Ribosomal RNA small subunit methyltransferase J Acinetobacter baumannii (strain ACICU)
Q4FR06 3.46e-18 85 34 9 208 3 rsmJ Ribosomal RNA small subunit methyltransferase J Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q994 3.55e-16 79 30 9 207 3 rsmJ Ribosomal RNA small subunit methyltransferase J Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14020
Feature type CDS
Gene rsmJ
Product 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ
Location 13960 - 14727 (strand: 1)
Length 768 (nucleotides) / 255 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1629
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04445 Putative SAM-dependent methyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15984 16S rRNA (guanine1516-N2)-methyltransferase [EC:2.1.1.242] - -

Protein Sequence

MNIRLQCEEGADNCALNALAVRWGLVHDETAPMALVLTPEGLELRKCDEPKLGGIRVDFAGGTMAHRRRFGGGRGEAVAKAVGIKKSYVPSVVDATAGLGRDAFVLASLGCRVRMIERHPVVAALLDDGLQRAYQDSEIGSWMRERMVLIHASGIDALADISPPPEVVYLDPMYPHRQKSALVKKEMRVFQSLVGADEDADKLLTPALALATRRVVVKRPDYAEPLAGQKAPAALETKSHRFDIYPCIKAEADAE

Flanking regions ( +/- flanking 50bp)

AACCAGAGCTGGATGCGATGTTAAAAGGCTACGGAATCAACGGGTAATAAGTGAATATTCGTTTACAGTGTGAGGAGGGCGCAGATAACTGCGCCCTTAACGCGTTAGCTGTGCGCTGGGGTCTGGTGCATGATGAAACGGCACCGATGGCATTGGTACTGACACCGGAAGGGCTGGAACTGCGCAAGTGCGATGAACCGAAACTCGGCGGGATCCGCGTGGATTTTGCGGGTGGCACCATGGCACACCGGCGGCGTTTCGGCGGCGGGCGCGGGGAAGCAGTTGCGAAAGCAGTCGGGATAAAAAAATCCTATGTGCCGTCCGTGGTGGATGCGACCGCCGGTCTGGGGCGTGATGCGTTTGTGCTGGCGTCTCTGGGCTGCCGGGTGCGCATGATAGAGCGCCATCCGGTTGTCGCGGCATTGCTGGATGATGGCTTACAGCGCGCGTATCAGGACAGTGAGATCGGCAGTTGGATGCGTGAGCGGATGGTATTGATCCACGCATCCGGTATTGATGCCCTTGCGGATATTTCGCCGCCGCCGGAAGTGGTGTATCTCGACCCGATGTATCCGCACCGGCAGAAAAGTGCGTTGGTTAAAAAAGAGATGCGGGTATTTCAGTCGCTGGTGGGGGCAGATGAGGATGCAGATAAACTGCTAACACCTGCTCTGGCACTTGCAACCCGGCGTGTCGTGGTGAAGCGTCCGGATTACGCAGAGCCGTTAGCGGGGCAGAAAGCACCGGCCGCGCTGGAGACAAAAAGCCATCGTTTTGATATCTATCCCTGCATAAAAGCAGAGGCCGACGCAGAATAACTGATGCGGTCAGTGTGAAAGGGGGACAGGGCAGTTCCCGTTTCGCGAAG