Homologs in group_3827

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS02300 F4V73_RS02300 89.6 Morganella psychrotolerans yajD HNH nuclease YajD

Distribution of the homologs in the orthogroup group_3827

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3827

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1S8 4.88e-80 233 91 0 115 3 yajD Putative HNH nuclease YajD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1S9 4.88e-80 233 91 0 115 3 yajD Putative HNH nuclease YajD Salmonella typhi
P0AAQ5 9.15e-79 229 89 0 115 3 yajD Putative HNH nuclease YajD Shigella flexneri
P0AAQ2 9.15e-79 229 89 0 115 3 yajD Putative HNH nuclease YajD Escherichia coli (strain K12)
P0AAQ3 9.15e-79 229 89 0 115 3 yajD Putative HNH nuclease YajD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAQ4 9.15e-79 229 89 0 115 3 yajD Putative HNH nuclease YajD Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14770
Feature type CDS
Gene yajD
Product HNH nuclease YajD
Location 3276048 - 3276395 (strand: 1)
Length 348 (nucleotides) / 115 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3827
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF01844 HNH endonuclease

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1403 Defense mechanisms (V) V 5-methylcytosine-specific restriction endonuclease McrA

Protein Sequence

MAVIPKNYAKLESGYREKALKLYPWVCGRCAREFVYSNLRELTVHHIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEAEEYGSTVVAGEDAQDDVGQATYNPFADLKAMLNKKK

Flanking regions ( +/- flanking 50bp)

AGAAGTAACCAAAAAACTTTCTCTATCATTTATAACAGGCAAAATAAACCATGGCTGTGATCCCCAAAAACTATGCAAAACTAGAAAGCGGTTACCGCGAAAAGGCGCTAAAACTCTACCCTTGGGTTTGTGGACGTTGTGCTCGTGAATTTGTCTATTCAAATCTGCGTGAATTAACCGTTCATCATATTGATCACGACCACACCAATAATCCCGAAGATGGCAGTAACTGGGAGTTACTGTGTCTGTATTGTCATGATCATGAGCACTCAAAATACACAGAAGCAGAAGAGTACGGCTCTACCGTTGTAGCAGGGGAAGATGCCCAAGATGATGTTGGGCAAGCAACCTATAACCCTTTTGCTGATTTAAAAGCGATGCTGAATAAGAAAAAGTGATCTAATCGTTATCACGACTGAGAATTGACATCCTCCACGCCCTAAAGGAC