Homologs in group_804

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03795 FBDBKF_03795 85.8 Morganella morganii S1 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
EHELCC_06740 EHELCC_06740 85.8 Morganella morganii S2 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
NLDBIP_07065 NLDBIP_07065 85.8 Morganella morganii S4 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
LHKJJB_06600 LHKJJB_06600 85.8 Morganella morganii S3 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
HKOGLL_04330 HKOGLL_04330 85.8 Morganella morganii S5 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
F4V73_RS11075 F4V73_RS11075 83.7 Morganella psychrotolerans - MurR/RpiR family transcriptional regulator

Distribution of the homologs in the orthogroup group_804

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_804

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37767 1.43e-16 80 23 3 252 4 yfhH Uncharacterized HTH-type transcriptional regulator YfhH Escherichia coli (strain K12)
A8ADG3 1.85e-13 71 23 7 267 3 murR HTH-type transcriptional regulator MurR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8RD36 3.61e-13 70 25 4 241 4 TTE0211 Uncharacterized HTH-type transcriptional regulator TTE0211 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B7NPW3 3.98e-13 70 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LMM1 9.82e-13 69 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain SMS-3-5 / SECEC)
P54717 1.27e-12 68 25 6 213 2 glvR HTH-type transcriptional regulator GlvR Bacillus subtilis (strain 168)
P77245 5.22e-12 67 22 4 257 1 murR HTH-type transcriptional regulator MurR Escherichia coli (strain K12)
B1XA98 5.22e-12 67 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain K12 / DH10B)
C4ZVV8 5.22e-12 67 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain K12 / MC4100 / BW2952)
Q3YZB5 5.43e-12 67 22 4 257 3 murR HTH-type transcriptional regulator MurR Shigella sonnei (strain Ss046)
A9MIE1 5.58e-12 67 22 6 259 3 murR HTH-type transcriptional regulator MurR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32DC7 5.87e-12 67 22 4 257 3 murR HTH-type transcriptional regulator MurR Shigella dysenteriae serotype 1 (strain Sd197)
B7LCH1 1.04e-11 66 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain 55989 / EAEC)
B6I503 1.6e-11 66 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain SE11)
B7M6T6 1.6e-11 66 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli O8 (strain IAI1)
A7ZPM7 1.6e-11 66 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli O139:H28 (strain E24377A / ETEC)
A8A2S4 2.33e-11 65 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli O9:H4 (strain HS)
P0ACS7 2.63e-11 65 20 4 250 1 rpiR HTH-type transcriptional regulator RpiR Escherichia coli (strain K12)
P0ACS8 2.63e-11 65 20 4 250 3 rpiR HTH-type transcriptional regulator RpiR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
C6UQ16 3.09e-11 65 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli O157:H7 (strain TW14359 / EHEC)
B5YZX2 3.09e-11 65 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XBJ3 3.09e-11 65 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli O157:H7
P26833 3.68e-11 65 22 2 243 4 CPE0189 Uncharacterized HTH-type transcriptional regulator CPE0189 Clostridium perfringens (strain 13 / Type A)
B1IX45 3.82e-11 65 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7LKK8 6.44e-11 64 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7N617 6.51e-11 64 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B2TX16 8.28e-11 63 22 3 244 3 murR HTH-type transcriptional regulator MurR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q97MK5 8.4e-11 63 22 2 250 4 CA_C0191 Uncharacterized HTH-type transcriptional regulator CA_C0191 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
C6UMS6 9.86e-11 63 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain B / REL606)
C5W7D8 9.86e-11 63 22 4 257 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain B / BL21-DE3)
P46117 1.53e-10 63 23 2 221 4 None Uncharacterized HTH-type transcriptional regulator in aarA 3'region Providencia stuartii
Q83K75 2.25e-10 62 22 3 244 3 murR HTH-type transcriptional regulator MurR Shigella flexneri
Q0T281 3.83e-10 62 22 3 244 3 murR HTH-type transcriptional regulator MurR Shigella flexneri serotype 5b (strain 8401)
Q31Y52 4.02e-10 62 22 3 244 3 murR HTH-type transcriptional regulator MurR Shigella boydii serotype 4 (strain Sb227)
Q88P32 1.22e-08 57 20 2 202 1 hexR HTH-type transcriptional regulator HexR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P44540 2.91e-08 56 20 3 245 4 HI_0143 Uncharacterized HTH-type transcriptional regulator HI_0143 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q45581 1.65e-07 54 21 3 239 1 ybbH Uncharacterized HTH-type transcriptional regulator YbbH Bacillus subtilis (strain 168)
O68281 2.01e-07 54 21 2 202 3 hexR HTH-type transcriptional regulator HexR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9YAK0 2.8e-05 47 25 1 124 3 APE_1940.1 Uncharacterized protein APE_1940.1 Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q9HVW0 3.36e-05 47 25 2 128 1 kdsD Arabinose 5-phosphate isomerase KdsD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9WYG1 0.000193 45 21 4 246 4 TM_0326 Uncharacterized HTH-type transcriptional regulator TM_0326 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14750
Feature type CDS
Gene -
Product MurR/RpiR family transcriptional regulator
Location 3273031 - 3273771 (strand: -1)
Length 741 (nucleotides) / 246 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_804
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01380 SIS domain
PF01418 Helix-turn-helix domain, rpiR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1737 Transcription (K) K DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains

Protein Sequence

MLDFLKNYDNLTVSEKKVLKYLTDNIADIPYLNINDLVAKTFVSKTVIINLSQKLGFSGFKELKFQINNYILSRNKIEKSDHSSYKKQLEKNINKSFTLINEEQIKECAKTLRHSRNIFIVARGTSKAVGYYLEHLLFALGLHCFFINDYNLSDSFTRLVNEDDTVIFISLSGGTKKIIETAKIVQLKEANIISMTAFNTNELTSYATHTLFCFADNHDTKKDDTKSRIGFFILVDLLINEIENLL

Flanking regions ( +/- flanking 50bp)

ATATGCTTAACTGATTGTTTTATCATGATTATTAATTGATTAGGTGAGATATGCTGGATTTTTTAAAAAATTATGACAATTTAACCGTCAGTGAAAAGAAAGTATTAAAGTATCTTACCGATAATATCGCCGATATCCCCTATTTAAATATTAATGATTTAGTCGCTAAAACCTTTGTATCAAAAACGGTAATTATTAATTTATCGCAGAAGTTAGGTTTTAGTGGCTTTAAAGAGCTAAAGTTTCAAATTAATAATTATATTCTTTCGCGTAATAAAATAGAAAAGAGTGATCACTCATCTTATAAAAAACAACTAGAGAAGAATATTAATAAAAGCTTTACCCTCATCAATGAAGAGCAAATTAAAGAGTGTGCTAAAACACTGCGCCATTCTCGTAATATTTTTATTGTGGCAAGGGGAACAAGTAAAGCAGTCGGTTATTATCTTGAACACTTATTGTTTGCACTGGGCCTGCATTGCTTTTTTATTAATGATTATAACTTATCAGATTCATTTACACGTTTAGTGAATGAAGATGACACGGTTATTTTTATCTCTCTTTCAGGGGGAACTAAAAAGATCATTGAAACGGCAAAAATTGTGCAGTTAAAAGAGGCAAACATTATCAGTATGACAGCCTTTAATACCAATGAGTTAACCAGTTATGCGACGCATACGCTATTTTGTTTCGCGGATAATCATGATACGAAAAAAGATGATACCAAGTCACGAATTGGTTTTTTTATTTTGGTTGATTTGTTAATAAATGAAATAGAAAATCTACTTTAAACATTATTTTTTAGTCTCAGAATGATCTCTTCAAGATTAACTTTTTCACG