Homologs in group_699

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02990 FBDBKF_02990 90.6 Morganella morganii S1 yocR Na+-dependent transporter, SNF family
EHELCC_07545 EHELCC_07545 90.6 Morganella morganii S2 yocR Na+-dependent transporter, SNF family
NLDBIP_07870 NLDBIP_07870 90.6 Morganella morganii S4 yocR Na+-dependent transporter, SNF family
LHKJJB_07405 LHKJJB_07405 90.6 Morganella morganii S3 yocR Na+-dependent transporter, SNF family
HKOGLL_03525 HKOGLL_03525 90.6 Morganella morganii S5 yocR Na+-dependent transporter, SNF family
F4V73_RS11920 F4V73_RS11920 90.6 Morganella psychrotolerans - sodium-dependent transporter

Distribution of the homologs in the orthogroup group_699

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_699

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O07577 1.49e-102 315 40 4 441 3 yhdH Uncharacterized sodium-dependent transporter YhdH Bacillus subtilis (strain 168)
O34383 2.23e-99 307 41 4 439 3 yocR Uncharacterized sodium-dependent transporter YocR Bacillus subtilis (strain 168)
P45320 7.89e-87 275 33 6 453 3 HI_1690 Uncharacterized sodium-dependent transporter HI_1690 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q58715 1.65e-43 162 30 11 454 3 MJ1319 Uncharacterized sodium-dependent transporter MJ1319 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P44849 1.84e-39 151 32 8 383 3 HI_0736 Uncharacterized sodium-dependent transporter HI_0736 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31646 8.65e-34 137 24 16 486 1 Slc6a13 Sodium- and chloride-dependent GABA transporter 2 Rattus norvegicus
A5PJX7 2e-32 132 24 11 440 2 SLC6A13 Sodium- and chloride-dependent GABA transporter 2 Bos taurus
P31649 3.39e-32 132 24 12 441 1 Slc6a13 Sodium- and chloride-dependent GABA transporter 2 Mus musculus
P31647 6.9e-32 131 25 11 482 1 Slc6a11 Sodium- and chloride-dependent GABA transporter 3 Rattus norvegicus
P31650 9.45e-32 131 25 11 482 1 Slc6a11 Sodium- and chloride-dependent GABA transporter 3 Mus musculus
P48066 9.51e-32 131 26 11 482 1 SLC6A11 Sodium- and chloride-dependent GABA transporter 3 Homo sapiens
Q2PG55 1.08e-31 130 25 16 483 2 SLC6A13 Sodium- and chloride-dependent GABA transporter 2 Macaca fascicularis
Q9NSD5 6.05e-31 128 26 14 440 1 SLC6A13 Sodium- and chloride-dependent GABA transporter 2 Homo sapiens
P23978 8e-30 125 27 16 475 1 Slc6a1 Sodium- and chloride-dependent GABA transporter 1 Rattus norvegicus
P31648 8e-30 125 27 16 475 1 Slc6a1 Sodium- and chloride-dependent GABA transporter 1 Mus musculus
P30531 1.04e-29 125 26 16 479 1 SLC6A1 Sodium- and chloride-dependent GABA transporter 1 Homo sapiens
Q9XT49 1.18e-29 125 25 11 422 1 SLC6A4 Sodium-dependent serotonin transporter Bos taurus
Q9MYX0 2.74e-29 124 24 12 426 2 SLC6A4 Sodium-dependent serotonin transporter Macaca mulatta
Q9VR07 3.2e-29 124 25 12 488 1 ine Sodium- and chloride-dependent GABA transporter ine Drosophila melanogaster
P51905 3.52e-29 123 26 18 504 2 SerT Sodium-dependent serotonin transporter Drosophila melanogaster
P31645 3.74e-29 123 24 10 422 1 SLC6A4 Sodium-dependent serotonin transporter Homo sapiens
P48057 9.5e-28 119 26 16 478 1 Slc6a1 Sodium- and chloride-dependent GABA transporter 1 Mus cookii
O35899 1.11e-27 119 24 10 423 1 SLC6A4 Sodium-dependent serotonin transporter Cavia porcellus
P48065 7.31e-27 116 25 9 434 1 SLC6A12 Sodium- and chloride-dependent betaine transporter Homo sapiens
P51143 8.28e-27 116 23 13 492 1 SLC6A2 Sodium-dependent noradrenaline transporter Bos taurus
P31651 1.77e-26 115 24 9 458 1 Slc6a12 Sodium- and chloride-dependent betaine transporter Mus musculus
Q60857 2.33e-26 115 24 13 428 1 Slc6a4 Sodium-dependent serotonin transporter Mus musculus
P23977 2.5e-26 115 24 12 482 1 Slc6a3 Sodium-dependent dopamine transporter Rattus norvegicus
Q61327 3.66e-26 114 24 12 482 1 Slc6a3 Sodium-dependent dopamine transporter Mus musculus
P31652 4.51e-26 114 24 13 426 1 Slc6a4 Sodium-dependent serotonin transporter Rattus norvegicus
O55192 6.18e-26 114 24 14 504 1 Slc6a2 Sodium-dependent noradrenaline transporter Mus musculus
Q01959 8.72e-26 113 26 11 442 1 SLC6A3 Sodium-dependent dopamine transporter Homo sapiens
P23975 1.08e-25 113 23 13 501 1 SLC6A2 Sodium-dependent noradrenaline transporter Homo sapiens
P27922 1.25e-25 113 25 14 485 1 SLC6A3 Sodium-dependent dopamine transporter Bos taurus
Q9GJT6 6.52e-25 110 26 11 442 2 SLC6A3 Sodium-dependent dopamine transporter Macaca fascicularis
P48055 1.12e-24 110 24 6 430 2 SLC6A12 Sodium- and chloride-dependent betaine transporter Oryctolagus cuniculus
P27799 1.26e-24 110 25 8 442 1 SLC6A12 Sodium- and chloride-dependent betaine transporter Canis lupus familiaris
Q00589 1.74e-23 106 26 19 489 1 SLC6A6 Sodium- and chloride-dependent taurine transporter Canis lupus familiaris
Q9MZ34 1.07e-22 104 27 15 433 1 SLC6A6 Sodium- and chloride-dependent taurine transporter Bos taurus
P48056 2.08e-22 103 25 11 464 1 Slc6a12 Sodium- and chloride-dependent betaine transporter Rattus norvegicus
Q91502 5.22e-22 102 24 15 494 2 None Creatine transporter Torpedo marmorata
P31641 6.33e-22 102 25 17 494 1 SLC6A6 Sodium- and chloride-dependent taurine transporter Homo sapiens
Q7K4Y6 4e-20 96 30 8 276 1 DAT Sodium-dependent dopamine transporter Drosophila melanogaster
Q7K4Y6 6.98e-05 48 24 1 125 1 DAT Sodium-dependent dopamine transporter Drosophila melanogaster
Q761V0 7.88e-20 95 24 10 452 1 Slc6a5 Sodium- and chloride-dependent glycine transporter 2 Mus musculus
Q6PGE7 1.99e-19 94 25 17 497 1 Slc6a7 Sodium-dependent proline transporter Mus musculus
P28573 2.05e-19 94 25 17 497 1 Slc6a7 Sodium-dependent proline transporter Rattus norvegicus
Q99884 1.03e-18 92 26 12 402 1 SLC6A7 Sodium-dependent proline transporter Homo sapiens
B4GVM9 3.01e-18 90 22 14 504 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila persimilis
A7Y2X0 3.37e-18 90 23 12 452 2 slc6a5 Sodium- and chloride-dependent glycine transporter 2 Xenopus laevis
Q29GB8 4.02e-18 90 22 14 504 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila pseudoobscura pseudoobscura
P58295 5.51e-18 90 23 10 452 1 Slc6a5 Sodium- and chloride-dependent glycine transporter 2 Rattus norvegicus
O18875 1.05e-17 89 24 17 497 2 SLC6A8 Sodium- and chloride-dependent creatine transporter 1 Bos taurus
G5EBN9 6.93e-17 86 21 10 390 1 snf-3 Sodium- and chloride-dependent betaine transporter Caenorhabditis elegans
P28570 1.07e-16 85 24 18 498 1 Slc6a8 Sodium- and chloride-dependent creatine transporter 1 Rattus norvegicus
Q8VBW1 1.07e-16 85 24 18 498 1 Slc6a8 Sodium- and chloride-dependent creatine transporter 1 Mus musculus
B4L7U0 1.21e-16 85 23 11 439 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila mojavensis
P48029 1.68e-16 85 23 17 498 1 SLC6A8 Sodium- and chloride-dependent creatine transporter 1 Homo sapiens
Q9D687 4.84e-16 84 23 9 363 1 Slc6a19 Sodium-dependent neutral amino acid transporter B(0)AT1 Mus musculus
Q2A865 6.22e-16 83 23 9 363 1 Slc6a19 Sodium-dependent neutral amino acid transporter B(0)AT1 Rattus norvegicus
B4JMC1 1.06e-15 82 23 15 499 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila grimshawi
Q9W4C5 1.24e-15 82 21 12 506 1 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila melanogaster
P31661 2.3e-15 82 24 21 498 1 SLC6A8 Sodium- and chloride-dependent creatine transporter 1 Oryctolagus cuniculus
B4NDL8 3.82e-15 81 22 11 446 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila willistoni
Q9H1V8 3.89e-15 81 27 10 302 1 SLC6A17 Sodium-dependent neutral amino acid transporter SLC6A17 Homo sapiens
O88576 4.5e-15 80 24 10 297 1 Slc6a18 Sodium-dependent neutral amino acid transporter B(0)AT3 Mus musculus
Q62687 1.14e-14 79 24 10 297 2 Slc6a18 Sodium-dependent neutral amino acid transporter B(0)AT3 Rattus norvegicus
Q9Y345 1.39e-14 79 27 4 249 1 SLC6A5 Sodium- and chloride-dependent glycine transporter 2 Homo sapiens
Q9Y345 2.03e-07 57 37 0 72 1 SLC6A5 Sodium- and chloride-dependent glycine transporter 2 Homo sapiens
B4MEG2 2.39e-14 79 22 16 511 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila virilis
P31662 2.61e-14 79 26 10 302 1 Slc6a17 Sodium-dependent neutral amino acid transporter SLC6A17 Rattus norvegicus
Q8BJI1 4.04e-14 78 26 10 302 1 Slc6a17 Sodium-dependent neutral amino acid transporter SLC6A17 Mus musculus
Q96N87 6.4e-14 77 23 8 295 2 SLC6A18 Inactive sodium-dependent neutral amino acid transporter B(0)AT3 Homo sapiens
Q695T7 7.91e-14 77 21 10 360 1 SLC6A19 Sodium-dependent neutral amino acid transporter B(0)AT1 Homo sapiens
Q28039 2.1e-13 75 23 15 422 2 SLC6A9 Sodium- and chloride-dependent glycine transporter 1 Bos taurus
Q5R6J1 2.24e-13 75 22 11 361 2 SLC6A19 Sodium-dependent neutral amino acid transporter B(0)AT1 Pongo abelii
Q9JMA9 3.83e-13 75 28 9 284 1 Slc6a14 Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) Mus musculus
Q9JMA9 4.54e-05 49 34 0 61 1 Slc6a14 Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) Mus musculus
P28572 7.52e-13 73 23 14 422 1 Slc6a9 Sodium- and chloride-dependent glycine transporter 1 Rattus norvegicus
P28571 1.35e-12 73 23 14 422 1 Slc6a9 Sodium- and chloride-dependent glycine transporter 1 Mus musculus
Q03614 1.57e-12 73 26 4 224 2 dat-1 Sodium-dependent dopamine transporter Caenorhabditis elegans
Q03614 3.55e-06 53 25 1 108 2 dat-1 Sodium-dependent dopamine transporter Caenorhabditis elegans
P48067 1.63e-12 73 22 11 419 1 SLC6A9 Sodium- and chloride-dependent glycine transporter 1 Homo sapiens
O45813 2.84e-12 72 24 11 378 1 snf-12 Sodium-dependent transporter snf-12 Caenorhabditis elegans
Q5R9C2 4.71e-12 71 23 7 298 2 SLC6A15 Sodium-dependent neutral amino acid transporter B(0)AT2 Pongo abelii
Q9UN76 5.95e-12 71 27 6 259 1 SLC6A14 Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) Homo sapiens
Q9UN76 5.05e-05 49 34 0 61 1 SLC6A14 Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) Homo sapiens
Q9H2J7 7.53e-12 71 23 7 298 1 SLC6A15 Sodium-dependent neutral amino acid transporter B(0)AT2 Homo sapiens
O35316 1.12e-11 70 29 9 257 1 Slc6a6 Sodium- and chloride-dependent taurine transporter Mus musculus
O35316 3.06e-10 65 35 0 77 1 Slc6a6 Sodium- and chloride-dependent taurine transporter Mus musculus
A7Y2W8 2.3e-11 69 26 8 315 2 slc6a9 Sodium- and chloride-dependent glycine transporter 1 Xenopus laevis
A7Y2W8 0.000441 46 30 0 56 2 slc6a9 Sodium- and chloride-dependent glycine transporter 1 Xenopus laevis
P31643 3.95e-11 68 28 9 262 1 Slc6a6 Sodium- and chloride-dependent taurine transporter Rattus norvegicus
P31643 3.43e-10 65 35 0 77 1 Slc6a6 Sodium- and chloride-dependent taurine transporter Rattus norvegicus
Q8BG16 6.63e-11 68 23 8 298 1 Slc6a15 Sodium-dependent neutral amino acid transporter B(0)AT2 Mus musculus
Q9NP91 2.01e-10 66 22 7 296 1 SLC6A20 Sodium- and chloride-dependent transporter XTRP3 Homo sapiens
Q64093 2.14e-10 66 21 7 294 2 Slc6a20 Sodium- and chloride-dependent transporter XTRP3 Rattus norvegicus
B4R4T6 4.93e-10 65 26 7 256 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila simulans
B4R4T6 7.53e-07 55 29 1 116 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila simulans
O88575 5.25e-10 65 20 4 289 1 Slc6a20b Sodium- and chloride-dependent transporter XTRP3B Mus musculus
Q08469 5.41e-10 65 23 8 298 1 Slc6a15 Sodium-dependent neutral amino acid transporter B(0)AT2 Rattus norvegicus
Q8VDB9 7.15e-10 64 20 4 289 1 Slc6a20a Sodium- and chloride-dependent transporter XTRP3A Mus musculus
Q9XS59 7.56e-10 64 22 7 299 2 SLC6A15 Sodium-dependent neutral amino acid transporter B(0)AT2 Bos taurus
B3NV41 1.08e-09 64 23 8 320 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila erecta
B3NV41 8.13e-07 55 29 1 116 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila erecta
B4PZQ4 1.22e-09 63 26 7 256 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila yakuba
B4PZQ4 7.85e-07 55 29 1 116 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila yakuba
B3MRS1 1.92e-07 57 22 10 323 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila ananassae
B3MRS1 1.12e-06 54 29 1 116 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila ananassae
O76689 3.9e-06 53 26 2 112 1 snf-6 Sodium-dependent acetylcholine transporter Caenorhabditis elegans
G5EBM5 7.03e-05 48 30 2 110 2 snf-5 Sodium-dependent transporter snf-5 Caenorhabditis elegans
Q28001 0.000131 46 25 10 228 2 SLC6A17 Sodium-dependent neutral amino acid transporter SLC6A17 (Fragment) Bos taurus
Q9GZN6 0.000198 47 28 4 110 1 SLC6A16 Orphan sodium- and chloride-dependent neurotransmitter transporter NTT5 Homo sapiens

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14735
Feature type CDS
Gene -
Product sodium-dependent transporter
Location 3268333 - 3269649 (strand: 1)
Length 1317 (nucleotides) / 438 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_699
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00209 Sodium:neurotransmitter symporter family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0733 General function prediction only (R) R Na+-dependent transporter, SNF family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03308 neurotransmitter:Na+ symporter, NSS family - -

Protein Sequence

MSQQWTSRVGHILAAAGSAIGIGAIWKFSYVAANNGGGAFLVVFLLFSFIIGLAVLLAENILGSSTHAEAVNAFKKMMGRNWVIIGVIGVFSSWCIYSFYSVVGGWTIGYTIMAATGELNITDSSELTGIFTRFISDPLWPILAHLVFAGLTCFVVLAGVQRGLEKAVKIMMPLLFIIMIILIIVGISLPGSSEGLKLFLYPDFSKLTPQGVLDALGLAFFSLSIGLGIHITYSAYLADNKTIANSSMWVVILSCLVCVLAGLMIFPALTAAGLEPNAGPGLTFMTMPVYFANLPGGNILAVTFFVLLLMAALTSAISLLEHIVAYVQMRFQWTRRRAGLVVTASIMLMGIPVSLSFGPMSDVTLGGKTLFDLLDYLTSNILMPLFGIAMCLIFGWSRRANAVIPDNITGAKRQCLLLVWRYIGPICIGIILVHGLIG

Flanking regions ( +/- flanking 50bp)

TATTGTTCGGCAACCGTTTCTATCATTAACATAATGAAATCGGAGGCAAAATGAGCCAACAATGGACATCTCGTGTAGGCCATATTTTAGCAGCCGCTGGCTCTGCCATTGGTATTGGTGCAATTTGGAAGTTCTCTTATGTCGCCGCCAATAATGGGGGTGGTGCATTCCTCGTCGTCTTTCTGTTATTTAGCTTTATTATCGGATTAGCTGTTTTATTAGCTGAAAATATTTTAGGTAGTAGCACCCATGCCGAAGCCGTTAATGCCTTCAAAAAGATGATGGGACGTAATTGGGTAATTATCGGTGTCATTGGTGTATTTAGTTCATGGTGTATCTATAGCTTTTATAGTGTTGTCGGGGGGTGGACCATTGGTTACACCATTATGGCAGCTACTGGTGAATTAAATATTACTGATAGTAGTGAATTAACGGGGATCTTCACCCGTTTTATCAGTGACCCTTTATGGCCTATTCTTGCTCACTTGGTGTTTGCCGGATTAACATGTTTTGTCGTATTAGCGGGTGTTCAACGCGGATTAGAAAAAGCCGTCAAGATCATGATGCCATTGCTGTTTATTATCATGATTATTTTGATTATTGTCGGTATTAGCTTACCCGGCTCTTCAGAAGGTTTAAAATTATTCTTATATCCTGATTTTAGTAAATTAACCCCACAAGGAGTGTTAGATGCGTTGGGATTAGCCTTCTTCTCGCTGTCTATCGGTTTGGGTATTCATATTACCTATAGCGCCTATTTAGCGGATAATAAGACTATTGCTAACTCTAGTATGTGGGTTGTGATCCTCTCTTGTTTAGTGTGTGTTTTAGCAGGCTTAATGATTTTCCCTGCGTTAACTGCTGCTGGATTAGAGCCAAATGCTGGCCCAGGCTTAACCTTTATGACCATGCCAGTCTATTTTGCTAACTTGCCTGGTGGCAATATCTTGGCGGTCACTTTCTTTGTTTTATTATTAATGGCAGCATTAACCTCTGCAATTTCATTACTCGAACATATCGTCGCTTATGTACAAATGCGTTTTCAGTGGACTCGCCGTAGAGCTGGCTTAGTGGTCACAGCCTCTATTATGTTAATGGGTATCCCAGTTTCATTATCATTTGGTCCTATGAGTGATGTAACTTTAGGGGGCAAAACACTCTTTGATTTATTGGATTACTTAACCTCCAATATCTTAATGCCACTGTTTGGTATTGCGATGTGTTTAATTTTTGGCTGGTCACGTAGAGCCAATGCGGTTATTCCAGATAATATTACTGGAGCAAAACGCCAATGCTTATTATTAGTTTGGCGTTATATCGGCCCTATCTGTATCGGTATAATATTGGTACATGGTTTGATTGGTTAAAAAACAAAAAGAGAGCTTCTTATTTAAGAAGCTCTCTGACTAATTATCCC