Homologs in group_769

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02990 FBDBKF_02990 94.7 Morganella morganii S1 yocR Na+-dependent transporter, SNF family
EHELCC_07545 EHELCC_07545 94.7 Morganella morganii S2 yocR Na+-dependent transporter, SNF family
NLDBIP_07870 NLDBIP_07870 94.7 Morganella morganii S4 yocR Na+-dependent transporter, SNF family
LHKJJB_07405 LHKJJB_07405 94.7 Morganella morganii S3 yocR Na+-dependent transporter, SNF family
HKOGLL_03525 HKOGLL_03525 94.7 Morganella morganii S5 yocR Na+-dependent transporter, SNF family
PMI_RS14735 PMI_RS14735 90.6 Proteus mirabilis HI4320 - sodium-dependent transporter

Distribution of the homologs in the orthogroup group_769

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_769

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O34383 2.9e-100 309 41 4 439 3 yocR Uncharacterized sodium-dependent transporter YocR Bacillus subtilis (strain 168)
O07577 1.01e-95 298 39 4 441 3 yhdH Uncharacterized sodium-dependent transporter YhdH Bacillus subtilis (strain 168)
P45320 2.64e-85 271 33 6 453 3 HI_1690 Uncharacterized sodium-dependent transporter HI_1690 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q58715 1.53e-46 170 30 10 453 3 MJ1319 Uncharacterized sodium-dependent transporter MJ1319 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P44849 2.05e-38 148 32 7 371 3 HI_0736 Uncharacterized sodium-dependent transporter HI_0736 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31646 4.21e-31 129 25 17 486 1 Slc6a13 Sodium- and chloride-dependent GABA transporter 2 Rattus norvegicus
Q9MYX0 8.7e-31 128 24 8 422 2 SLC6A4 Sodium-dependent serotonin transporter Macaca mulatta
P31645 1.55e-30 127 24 8 422 1 SLC6A4 Sodium-dependent serotonin transporter Homo sapiens
Q9XT49 2.33e-30 127 25 9 422 1 SLC6A4 Sodium-dependent serotonin transporter Bos taurus
O35899 3.47e-30 126 25 11 424 1 SLC6A4 Sodium-dependent serotonin transporter Cavia porcellus
P31649 2.58e-29 124 24 16 486 1 Slc6a13 Sodium- and chloride-dependent GABA transporter 2 Mus musculus
P23978 4.66e-29 123 28 17 480 1 Slc6a1 Sodium- and chloride-dependent GABA transporter 1 Rattus norvegicus
P31648 4.66e-29 123 28 17 480 1 Slc6a1 Sodium- and chloride-dependent GABA transporter 1 Mus musculus
P30531 5.64e-29 122 27 16 480 1 SLC6A1 Sodium- and chloride-dependent GABA transporter 1 Homo sapiens
A5PJX7 7.17e-29 122 24 12 458 2 SLC6A13 Sodium- and chloride-dependent GABA transporter 2 Bos taurus
P31647 2.16e-28 121 25 12 483 1 Slc6a11 Sodium- and chloride-dependent GABA transporter 3 Rattus norvegicus
P31650 2.35e-28 121 25 12 483 1 Slc6a11 Sodium- and chloride-dependent GABA transporter 3 Mus musculus
P48066 5.47e-28 120 25 12 485 1 SLC6A11 Sodium- and chloride-dependent GABA transporter 3 Homo sapiens
P48057 1.18e-27 119 27 17 483 1 Slc6a1 Sodium- and chloride-dependent GABA transporter 1 Mus cookii
Q2PG55 1.56e-27 118 26 16 458 2 SLC6A13 Sodium- and chloride-dependent GABA transporter 2 Macaca fascicularis
P31652 2.15e-27 118 24 10 422 1 Slc6a4 Sodium-dependent serotonin transporter Rattus norvegicus
Q60857 2.21e-27 118 24 8 422 1 Slc6a4 Sodium-dependent serotonin transporter Mus musculus
Q9NSD5 5.33e-27 117 25 18 485 1 SLC6A13 Sodium- and chloride-dependent GABA transporter 2 Homo sapiens
P23977 4.21e-26 114 25 11 473 1 Slc6a3 Sodium-dependent dopamine transporter Rattus norvegicus
Q61327 4.58e-26 114 25 11 473 1 Slc6a3 Sodium-dependent dopamine transporter Mus musculus
P27922 6.19e-26 114 26 15 486 1 SLC6A3 Sodium-dependent dopamine transporter Bos taurus
Q9VR07 1.35e-25 113 24 17 489 1 ine Sodium- and chloride-dependent GABA transporter ine Drosophila melanogaster
Q01959 1.36e-25 113 25 14 483 1 SLC6A3 Sodium-dependent dopamine transporter Homo sapiens
P51905 4.24e-25 111 25 12 426 2 SerT Sodium-dependent serotonin transporter Drosophila melanogaster
O55192 5.89e-25 111 25 15 484 1 Slc6a2 Sodium-dependent noradrenaline transporter Mus musculus
Q9GJT6 1.01e-24 110 25 15 486 2 SLC6A3 Sodium-dependent dopamine transporter Macaca fascicularis
P48065 1.89e-24 109 24 16 488 1 SLC6A12 Sodium- and chloride-dependent betaine transporter Homo sapiens
P51143 2.18e-24 109 23 14 485 1 SLC6A2 Sodium-dependent noradrenaline transporter Bos taurus
P23975 3.57e-24 108 24 15 495 1 SLC6A2 Sodium-dependent noradrenaline transporter Homo sapiens
P31651 8.28e-24 107 24 12 459 1 Slc6a12 Sodium- and chloride-dependent betaine transporter Mus musculus
P48055 1.99e-22 103 24 8 438 2 SLC6A12 Sodium- and chloride-dependent betaine transporter Oryctolagus cuniculus
Q00589 2.09e-22 103 27 21 492 1 SLC6A6 Sodium- and chloride-dependent taurine transporter Canis lupus familiaris
P27799 2.16e-22 103 24 11 483 1 SLC6A12 Sodium- and chloride-dependent betaine transporter Canis lupus familiaris
Q761V0 2.61e-21 100 24 16 515 1 Slc6a5 Sodium- and chloride-dependent glycine transporter 2 Mus musculus
Q9MZ34 4.98e-21 99 27 17 435 1 SLC6A6 Sodium- and chloride-dependent taurine transporter Bos taurus
O35316 1.6e-20 97 25 18 496 1 Slc6a6 Sodium- and chloride-dependent taurine transporter Mus musculus
Q9Y345 2.01e-20 97 24 12 453 1 SLC6A5 Sodium- and chloride-dependent glycine transporter 2 Homo sapiens
P58295 2.03e-20 97 24 12 453 1 Slc6a5 Sodium- and chloride-dependent glycine transporter 2 Rattus norvegicus
P48056 4.92e-20 96 24 12 460 1 Slc6a12 Sodium- and chloride-dependent betaine transporter Rattus norvegicus
P31641 5.75e-20 95 25 17 497 1 SLC6A6 Sodium- and chloride-dependent taurine transporter Homo sapiens
P31643 5.81e-20 95 25 16 500 1 Slc6a6 Sodium- and chloride-dependent taurine transporter Rattus norvegicus
Q7K4Y6 5.29e-19 93 29 6 276 1 DAT Sodium-dependent dopamine transporter Drosophila melanogaster
Q7K4Y6 9.14e-05 48 24 1 117 1 DAT Sodium-dependent dopamine transporter Drosophila melanogaster
A7Y2X0 6.47e-19 93 22 15 514 2 slc6a5 Sodium- and chloride-dependent glycine transporter 2 Xenopus laevis
G5EBN9 2.49e-18 90 21 10 388 1 snf-3 Sodium- and chloride-dependent betaine transporter Caenorhabditis elegans
O18875 3.96e-17 87 24 17 500 2 SLC6A8 Sodium- and chloride-dependent creatine transporter 1 Bos taurus
P28573 3.97e-17 87 25 11 401 1 Slc6a7 Sodium-dependent proline transporter Rattus norvegicus
B4GVM9 5.03e-17 87 22 14 506 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila persimilis
Q29GB8 5.36e-17 87 22 14 506 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila pseudoobscura pseudoobscura
Q6PGE7 8.01e-17 86 25 13 402 1 Slc6a7 Sodium-dependent proline transporter Mus musculus
Q8VBW1 3.33e-16 84 24 17 500 1 Slc6a8 Sodium- and chloride-dependent creatine transporter 1 Mus musculus
P28570 3.36e-16 84 24 17 500 1 Slc6a8 Sodium- and chloride-dependent creatine transporter 1 Rattus norvegicus
B4L7U0 3.72e-16 84 21 13 507 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila mojavensis
P48029 4.63e-16 84 24 17 500 1 SLC6A8 Sodium- and chloride-dependent creatine transporter 1 Homo sapiens
Q9W4C5 9.14e-16 83 22 16 513 1 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila melanogaster
Q2A865 1.47e-15 82 24 12 371 1 Slc6a19 Sodium-dependent neutral amino acid transporter B(0)AT1 Rattus norvegicus
Q9D687 1.48e-15 82 23 12 371 1 Slc6a19 Sodium-dependent neutral amino acid transporter B(0)AT1 Mus musculus
B4MEG2 2.03e-15 82 22 15 511 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila virilis
B4JMC1 2.85e-15 81 22 14 499 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila grimshawi
Q96N87 3.35e-15 81 24 8 295 2 SLC6A18 Inactive sodium-dependent neutral amino acid transporter B(0)AT3 Homo sapiens
B4PZQ4 5.51e-15 80 22 16 512 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila yakuba
Q62687 8.11e-15 80 23 9 293 2 Slc6a18 Sodium-dependent neutral amino acid transporter B(0)AT3 Rattus norvegicus
O88576 8.48e-15 80 23 9 293 1 Slc6a18 Sodium-dependent neutral amino acid transporter B(0)AT3 Mus musculus
P31661 1.45e-14 79 23 17 500 1 SLC6A8 Sodium- and chloride-dependent creatine transporter 1 Oryctolagus cuniculus
Q695T7 1.73e-13 76 23 12 365 1 SLC6A19 Sodium-dependent neutral amino acid transporter B(0)AT1 Homo sapiens
B4NDL8 2.4e-13 75 22 17 517 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila willistoni
Q9H1V8 3.65e-13 75 24 11 300 1 SLC6A17 Sodium-dependent neutral amino acid transporter SLC6A17 Homo sapiens
P31662 6.43e-13 74 24 9 298 1 Slc6a17 Sodium-dependent neutral amino acid transporter SLC6A17 Rattus norvegicus
Q91502 6.79e-13 74 25 9 304 2 None Creatine transporter Torpedo marmorata
Q91502 7.1e-07 55 35 0 71 2 None Creatine transporter Torpedo marmorata
Q8BJI1 8.1e-13 73 24 9 298 1 Slc6a17 Sodium-dependent neutral amino acid transporter SLC6A17 Mus musculus
Q5R6J1 2.21e-12 72 22 11 359 2 SLC6A19 Sodium-dependent neutral amino acid transporter B(0)AT1 Pongo abelii
Q5R9C2 6.14e-12 71 23 6 299 2 SLC6A15 Sodium-dependent neutral amino acid transporter B(0)AT2 Pongo abelii
Q9H2J7 9.98e-12 70 23 6 299 1 SLC6A15 Sodium-dependent neutral amino acid transporter B(0)AT2 Homo sapiens
Q03614 1.03e-11 70 27 3 176 2 dat-1 Sodium-dependent dopamine transporter Caenorhabditis elegans
Q03614 5.29e-07 55 27 1 108 2 dat-1 Sodium-dependent dopamine transporter Caenorhabditis elegans
Q64093 1.68e-11 69 22 8 295 2 Slc6a20 Sodium- and chloride-dependent transporter XTRP3 Rattus norvegicus
Q28039 2.27e-11 69 23 13 419 2 SLC6A9 Sodium- and chloride-dependent glycine transporter 1 Bos taurus
Q9JMA9 2.8e-11 69 26 10 310 1 Slc6a14 Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) Mus musculus
Q9JMA9 3.26e-05 50 36 0 61 1 Slc6a14 Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) Mus musculus
O88575 3.52e-11 68 21 8 294 1 Slc6a20b Sodium- and chloride-dependent transporter XTRP3B Mus musculus
P28571 4.82e-11 68 22 12 419 1 Slc6a9 Sodium- and chloride-dependent glycine transporter 1 Mus musculus
Q8VDB9 5.64e-11 68 22 8 295 1 Slc6a20a Sodium- and chloride-dependent transporter XTRP3A Mus musculus
Q8BG16 6.57e-11 68 24 9 303 1 Slc6a15 Sodium-dependent neutral amino acid transporter B(0)AT2 Mus musculus
A7Y2W8 9.42e-11 67 27 5 226 2 slc6a9 Sodium- and chloride-dependent glycine transporter 1 Xenopus laevis
Q9NP91 1e-10 67 22 6 292 1 SLC6A20 Sodium- and chloride-dependent transporter XTRP3 Homo sapiens
Q9UN76 3.01e-10 65 25 9 290 1 SLC6A14 Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) Homo sapiens
Q9UN76 2.15e-05 50 37 0 61 1 SLC6A14 Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) Homo sapiens
Q9XS59 3.49e-10 65 24 11 302 2 SLC6A15 Sodium-dependent neutral amino acid transporter B(0)AT2 Bos taurus
Q99884 7.22e-10 64 28 5 213 1 SLC6A7 Sodium-dependent proline transporter Homo sapiens
Q99884 1.21e-05 51 36 0 61 1 SLC6A7 Sodium-dependent proline transporter Homo sapiens
Q08469 1.02e-09 64 23 9 303 1 Slc6a15 Sodium-dependent neutral amino acid transporter B(0)AT2 Rattus norvegicus
B4R4T6 1.15e-09 63 23 12 341 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila simulans
B4R4T6 8.06e-06 52 28 1 116 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila simulans
B3NV41 1.81e-09 63 23 12 342 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila erecta
B3NV41 7.71e-06 52 28 1 116 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila erecta
O45813 8.84e-09 61 23 13 446 1 snf-12 Sodium-dependent transporter snf-12 Caenorhabditis elegans
B3MRS1 3.87e-07 56 23 12 342 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila ananassae
B3MRS1 1.27e-05 51 28 1 116 3 NAAT1 Sodium-dependent nutrient amino acid transporter 1 Drosophila ananassae
P28572 5.25e-07 55 26 5 226 1 Slc6a9 Sodium- and chloride-dependent glycine transporter 1 Rattus norvegicus
P48067 8.93e-07 55 26 5 226 1 SLC6A9 Sodium- and chloride-dependent glycine transporter 1 Homo sapiens
O76689 1.17e-05 51 25 2 112 1 snf-6 Sodium-dependent acetylcholine transporter Caenorhabditis elegans
Q9GZN6 3.74e-05 49 28 3 110 1 SLC6A16 Orphan sodium- and chloride-dependent neurotransmitter transporter NTT5 Homo sapiens
Q28001 0.000151 46 32 4 91 2 SLC6A17 Sodium-dependent neutral amino acid transporter SLC6A17 (Fragment) Bos taurus
G5EBM5 0.00035 46 29 1 113 2 snf-5 Sodium-dependent transporter snf-5 Caenorhabditis elegans
Q0E961 0.000463 46 30 4 110 2 bdg Sodium-dependent transporter bedraggled Drosophila melanogaster

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11920
Feature type CDS
Gene -
Product sodium-dependent transporter
Location 537732 - 539048 (strand: 1)
Length 1317 (nucleotides) / 438 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_769
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00209 Sodium:neurotransmitter symporter family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0733 General function prediction only (R) R Na+-dependent transporter, SNF family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03308 neurotransmitter:Na+ symporter, NSS family - -

Protein Sequence

MSQQWTSRFGHILAAAGSAIGIGAIWKFSYVAASNGGGAFLIVFLLFSFVIGLAVLLAENILGSSTRAEAVNAFKQMMGRHWAWIGVIGVFSSWCIYSFYSVVGGWTIGYTVMAATGKLNITDSAELTGIFTRFISDPWWPVIAHLTFAGLTCFVVLAGVQRGLEKSVKIMMPLLFIIMIALIIIGISLPGSSAGLKLFLYPDFSKLTGKGVLDALGLAFFSLSIGLGIHITYSAYLSDNKGIANSSMWVVILSCMVCVLAGLMIFPALSAAGLAPDAGPGLTFMTMPVYFAHLPGGSVLAVTFFVLLLMAALTSAISLLEHIVAYVQMRFQWTRRRAGLVVTASIMLMGIPVSLSFGPLSDVTFGGKTVFDLLDYLTSNILMPLFGIAVCLIFGWSRKANALIPDNITGLKRQSLLLVWRYVGPICIGVILVHGLIG

Flanking regions ( +/- flanking 50bp)

GATTGTTCTGCCGCCGCCTCAGTCACTCAGATGACACAGAAGGAGGCCGCATGAGTCAGCAATGGACATCCCGCTTCGGGCATATTTTAGCCGCCGCCGGCTCTGCTATCGGCATCGGTGCTATCTGGAAATTCTCTTATGTTGCCGCATCTAACGGCGGTGGCGCCTTTCTGATCGTTTTTCTGTTATTCAGTTTTGTTATTGGTCTTGCCGTCTTACTGGCTGAAAATATTTTAGGCAGCAGTACGCGGGCTGAAGCCGTTAATGCATTTAAACAAATGATGGGACGCCACTGGGCATGGATTGGCGTTATCGGTGTATTCAGCTCATGGTGTATTTACAGCTTTTACAGTGTGGTCGGGGGCTGGACCATTGGTTATACGGTGATGGCGGCGACCGGTAAACTGAATATCACGGACAGCGCAGAACTGACCGGTATATTCACCCGCTTTATCAGTGATCCCTGGTGGCCGGTTATTGCTCATCTCACCTTTGCCGGTCTGACCTGTTTTGTGGTGCTGGCGGGTGTACAGCGCGGGCTGGAAAAATCGGTTAAGATAATGATGCCGCTGTTATTTATCATCATGATTGCATTGATTATCATTGGTATCAGCTTGCCGGGTTCGTCTGCCGGACTGAAATTATTTTTGTATCCTGATTTCAGCAAACTGACCGGGAAAGGGGTATTGGATGCACTGGGGCTGGCTTTTTTCTCGCTCTCAATAGGGCTGGGTATTCATATTACCTACAGCGCCTATTTATCTGATAATAAAGGTATTGCAAACTCAAGTATGTGGGTGGTTATTCTCTCCTGCATGGTATGTGTGCTGGCAGGTCTGATGATATTCCCTGCATTGTCTGCCGCCGGTTTAGCGCCGGATGCAGGTCCCGGTCTGACCTTTATGACTATGCCGGTTTATTTCGCCCACTTACCCGGTGGCTCTGTTCTGGCGGTCACTTTCTTTGTTTTATTACTGATGGCGGCGCTGACTTCCGCAATTTCATTGCTGGAGCACATTGTGGCATATGTTCAGATGCGTTTTCAGTGGACGCGCCGCAGGGCGGGTCTGGTGGTAACAGCATCGATTATGCTGATGGGAATTCCGGTGTCTTTATCATTCGGACCGCTGAGTGATGTCACTTTCGGCGGAAAAACGGTGTTTGATCTGCTGGATTACCTGACATCGAATATTCTGATGCCGTTGTTCGGTATTGCGGTCTGTCTGATTTTCGGCTGGTCACGTAAGGCGAATGCGCTGATCCCTGACAACATTACCGGTCTGAAACGTCAGAGCTTATTGTTGGTGTGGCGCTATGTGGGGCCGATTTGTATTGGTGTGATCCTGGTACATGGTCTGATTGGCTGACAGAAGAATAAAAAAAGCGGCAGGAAATTCTCCCTGCCGCTTTTGGTTTG