Homologs in group_3857

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS09150 F4V73_RS09150 46.2 Morganella psychrotolerans - PTS lactose/cellobiose transporter subunit IIA

Distribution of the homologs in the orthogroup group_3857

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3857

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P69794 6e-57 174 73 0 115 3 chbA PTS system N,N'-diacetylchitobiose-specific EIIA component Shigella flexneri
P69791 6e-57 174 73 0 115 1 chbA PTS system N,N'-diacetylchitobiose-specific EIIA component Escherichia coli (strain K12)
P69792 6e-57 174 73 0 115 3 chbA PTS system N,N'-diacetylchitobiose-specific EIIA component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69793 6e-57 174 73 0 115 3 chbA PTS system N,N'-diacetylchitobiose-specific EIIA component Escherichia coli O157:H7
Q45402 1.14e-23 90 41 0 99 1 celD PTS system cellobiose-specific EIIA component Geobacillus stearothermophilus
P46319 2.8e-22 87 42 0 101 2 licA Lichenan-specific phosphotransferase enzyme IIA component Bacillus subtilis (strain 168)
Q9CIE9 3.37e-17 74 32 0 105 2 ptcA PTS system cellobiose-specific EIIA component Lactococcus lactis subsp. lactis (strain IL1403)
A2RIE7 8.85e-17 73 34 0 98 2 ptcA PTS system galactose-specific EIIA component Lactococcus lactis subsp. cremoris (strain MG1363)
P11502 7.54e-16 70 35 0 104 1 lacF PTS system lactose-specific EIIA component Lacticaseibacillus casei
Q8CNF6 8.15e-14 65 34 0 99 3 lacF PTS system lactose-specific EIIA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM39 8.15e-14 65 34 0 99 3 lacF PTS system lactose-specific EIIA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P23532 3.23e-13 63 34 0 90 1 lacF PTS system lactose-specific EIIA component Lactococcus lactis subsp. lactis
P0A0D5 4.3e-13 63 34 0 90 3 lacF PTS system lactose-specific EIIA component Staphylococcus aureus (strain MW2)
P0A0D6 4.3e-13 63 34 0 90 1 lacF PTS system lactose-specific EIIA component Staphylococcus aureus
Q6G7C3 4.3e-13 63 34 0 90 3 lacF PTS system lactose-specific EIIA component Staphylococcus aureus (strain MSSA476)
Q6GEN8 4.3e-13 63 34 0 90 3 lacF PTS system lactose-specific EIIA component Staphylococcus aureus (strain MRSA252)
P0A0D4 4.3e-13 63 34 0 90 3 lacF PTS system lactose-specific EIIA component Staphylococcus aureus (strain N315)
P0A0D3 4.3e-13 63 34 0 90 3 lacF PTS system lactose-specific EIIA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HE14 4.3e-13 63 34 0 90 3 lacF PTS system lactose-specific EIIA component Staphylococcus aureus (strain COL)
O05506 8.72e-13 62 36 0 93 1 gmuA PTS system oligo-beta-mannoside-specific EIIA component Bacillus subtilis (strain 168)
P26426 3.15e-11 58 33 0 90 3 lacF PTS system lactose-specific EIIA component Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14605
Feature type CDS
Gene chbA
Product PTS N,N'-diacetylchitobiose transporter subunit IIA
Location 3237505 - 3237852 (strand: -1)
Length 348 (nucleotides) / 115 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3857
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF02255 PTS system, Lactose/Cellobiose specific IIA subunit

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1447 Carbohydrate transport and metabolism (G) G Phosphotransferase system cellobiose-specific component IIA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02759 cellobiose PTS system EIIA component [EC:2.7.1.196 2.7.1.205] Starch and sucrose metabolism
Phosphotransferase system (PTS)
-

Protein Sequence

MLDIENCVDSSATDDEFEEIIMGLIINSGQARSIAYAALKKAKQGDFAQAKKMMEQSRAALNEAHKIQTRLIGDDQGLGKTKVSLVLVHAQDHLMTSMLARELVTELIELHEKIK

Flanking regions ( +/- flanking 50bp)

TGGCTGTGCAGCGCTTATTTTGCACAGCTAAGCACCAAAGAGGGGGAATGATGTTAGATATTGAGAATTGCGTTGATAGCTCAGCGACAGATGATGAATTTGAAGAAATTATCATGGGGTTAATTATTAATTCAGGGCAAGCACGAAGTATCGCTTATGCAGCGTTAAAAAAAGCGAAGCAAGGTGATTTTGCACAAGCCAAGAAAATGATGGAACAATCTCGAGCAGCATTAAATGAAGCTCATAAAATACAGACCCGCTTAATTGGTGATGATCAAGGATTGGGTAAAACGAAAGTGAGCTTGGTACTGGTGCATGCTCAAGATCATTTAATGACATCTATGTTAGCCAGAGAGCTTGTCACAGAGCTTATCGAGTTACATGAAAAAATAAAGTAAGGCGAATGATGATGCACTCATTAAAAGCGCAAGCTGAAATACGCATGGTA