Homologs in group_3725

Help

2 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS06560 PMI_RS06560 39.6 Proteus mirabilis HI4320 - Ail/Lom family outer membrane beta-barrel protein
PMI_RS06595 PMI_RS06595 27.5 Proteus mirabilis HI4320 - outer membrane beta-barrel protein

Distribution of the homologs in the orthogroup group_3725

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3725

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P25253 8.95e-17 77 30 4 160 1 ompX Outer membrane protein X Enterobacter cloacae
P0A920 1.32e-16 76 31 8 197 3 ompX Outer membrane protein X Shigella flexneri
P0A917 1.32e-16 76 31 8 197 1 ompX Outer membrane protein X Escherichia coli (strain K12)
P0A918 1.32e-16 76 31 8 197 3 ompX Outer membrane protein X Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A919 1.32e-16 76 31 8 197 3 ompX Outer membrane protein X Escherichia coli O157:H7
P16454 5.65e-16 75 32 7 170 1 ail Attachment invasion locus protein Yersinia enterocolitica
P23988 1.86e-15 73 30 8 200 3 pagC Virulence membrane protein PagC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q56957 2.4e-15 73 31 8 193 3 ail Attachment invasion locus protein Yersinia pseudotuberculosis serotype I (strain IP32953)
P03701 3.64e-14 70 27 6 185 1 lom Outer membrane protein lom Escherichia phage lambda
P77184 0.001 39 53 0 26 5 lomR Putative protein LomR Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14585
Feature type CDS
Gene -
Product Ail/Lom family outer membrane beta-barrel protein
Location 3233661 - 3234227 (strand: 1)
Length 567 (nucleotides) / 188 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3725
Orthogroup size 3
N. genomes 1

Actions

Genomic region

Domains

PF13505 Outer membrane protein beta-barrel domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3637 Cell wall/membrane/envelope biogenesis (M) M Opacity protein LomR and related surface antigens

Protein Sequence

MKKQLLSALFISGIFSISTVQAHENTSLDKTTISAGYAQIKIAGQSGIMRGGNLSIRQEFNQQLGIMAIATYAQNEYDLNKPLKQLIKDVDARYYSVMAGPTLRLNDYISVYGVAGMAQIEFKGLDTRQVPESIIKKNAFSWGAGVTINPIDMLSVSVGYENSRYKMNKLSDNKLIIDGFIANIGYSF

Flanking regions ( +/- flanking 50bp)

TCATTACTATAATTCACCATTCTAAATAGTAAGCAAATGGGATATTAAAAATGAAAAAACAACTATTATCAGCATTATTTATCAGTGGAATATTTTCTATTTCTACCGTTCAAGCACATGAAAATACCTCATTAGATAAAACAACAATTTCTGCAGGTTATGCACAAATAAAAATTGCCGGCCAATCAGGCATTATGCGCGGTGGTAATCTCTCTATACGTCAAGAATTCAATCAACAGCTAGGTATTATGGCAATTGCTACCTATGCGCAAAATGAATATGATTTAAATAAGCCTTTAAAACAATTAATAAAAGATGTTGATGCCCGCTATTATTCAGTGATGGCGGGGCCAACCTTGCGCCTCAATGACTATATTAGTGTATATGGTGTGGCAGGTATGGCTCAAATCGAATTTAAAGGTTTAGATACTAGACAAGTACCTGAAAGTATAATCAAGAAAAATGCTTTTAGCTGGGGAGCCGGTGTTACCATTAACCCTATCGATATGCTTTCTGTTTCCGTTGGCTATGAAAACAGCCGTTATAAAATGAATAAATTAAGTGATAATAAATTAATTATTGATGGCTTTATTGCAAATATTGGTTATAGCTTCTAATTATTGATTTAATTAAATTATAAAAAAAGCCTCTGTCATTATCAATAACA