Homologs in group_1638

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10805 FBDBKF_10805 75.8 Morganella morganii S1 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
EHELCC_19395 EHELCC_19395 75.8 Morganella morganii S2 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
NLDBIP_14970 NLDBIP_14970 75.8 Morganella morganii S4 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
LHKJJB_14375 LHKJJB_14375 75.8 Morganella morganii S3 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
HKOGLL_12995 HKOGLL_12995 75.8 Morganella morganii S5 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
F4V73_RS14490 F4V73_RS14490 74.0 Morganella psychrotolerans - ABC transporter substrate-binding protein

Distribution of the homologs in the orthogroup group_1638

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1638

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O34563 5.72e-36 132 33 5 242 2 glnH ABC transporter glutamine-binding protein GlnH Bacillus subtilis (strain 168)
P0AEM9 2.63e-34 128 29 5 258 1 tcyJ L-cystine-binding protein TcyJ Escherichia coli (strain K12)
P0AEN0 2.63e-34 128 29 5 258 3 tcyJ L-cystine-binding protein TcyJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P30859 6.56e-28 110 28 3 251 1 artI Putative ABC transporter arginine-binding protein 2 Escherichia coli (strain K12)
P27676 6.07e-25 103 31 7 224 3 glnH Glutamine-binding protein Geobacillus stearothermophilus
P30860 1.62e-22 96 28 6 256 1 artJ ABC transporter arginine-binding protein 1 Escherichia coli (strain K12)
Q9ZF60 8.47e-20 90 29 9 279 3 gltI Glutamate/aspartate import solute-binding protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q06758 1.88e-19 88 26 6 225 3 hisJ Probable histidine-binding protein Neisseria gonorrhoeae
Q46125 3.66e-18 84 34 3 158 1 hisJ Probable histidine-binding protein Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9I402 8.96e-18 84 26 10 288 1 PA1342 L-glutamate/L-aspartate-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37902 3.17e-17 83 28 7 247 1 gltI Glutamate/aspartate import solute-binding protein Escherichia coli (strain K12)
P0AEQ3 2.86e-16 79 27 3 217 1 glnH Glutamine-binding periplasmic protein Escherichia coli (strain K12)
P0AEQ4 2.86e-16 79 27 3 217 3 glnH Glutamine-binding periplasmic protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ5 2.86e-16 79 27 3 217 3 glnH Glutamine-binding periplasmic protein Escherichia coli O157:H7
P49618 4.52e-16 79 29 6 219 3 lapT Arginine-binding periplasmic protein Mannheimia haemolytica
P45024 2e-15 77 24 5 262 1 HI_1080 Probable amino-acid ABC transporter-binding protein HI_1080 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P48242 2.02e-15 77 26 8 258 1 gluB Glutamate-binding protein GluB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P09551 4.28e-15 76 27 7 231 1 argT Lysine/arginine/ornithine-binding periplasmic protein Escherichia coli (strain K12)
G3XD47 4.61e-15 76 28 7 235 1 aotJ L-arginine-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8RQL6 9.06e-15 76 26 6 252 3 gluB Glutamate-binding protein GluB Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P42199 1.13e-14 75 25 7 238 1 tcyA L-cystine-binding protein TcyA Bacillus subtilis (strain 168)
A1VZQ4 2.62e-14 74 28 7 257 3 peb1A Major cell-binding factor Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0P9X8 3.88e-14 73 27 6 255 1 peb1A Major cell-binding factor Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P02911 3.08e-13 71 25 5 229 1 argT Lysine/arginine/ornithine-binding periplasmic protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45091 6.02e-12 67 26 6 220 1 artI ABC transporter arginine-binding protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P54535 1.27e-11 66 25 6 216 1 artP Arginine-binding extracellular protein ArtP Bacillus subtilis (strain 168)
P0AEU0 2.09e-11 66 25 7 224 1 hisJ Histidine-binding periplasmic protein Escherichia coli (strain K12)
P0AEU1 2.09e-11 66 25 7 224 3 hisJ Histidine-binding periplasmic protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU2 2.09e-11 66 25 7 224 3 hisJ Histidine-binding periplasmic protein Escherichia coli O157:H7
P52626 2.55e-11 65 26 8 236 3 patH Putative amino-acid ABC transporter-binding protein PatH Vibrio harveyi
P02910 6.54e-11 64 26 8 225 1 hisJ Histidine-binding periplasmic protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q01269 4.53e-10 62 25 3 168 1 pheC Cyclohexadienyl dehydratase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KTN5 1.18e-09 62 34 3 106 3 mltF Membrane-bound lytic murein transglycosylase F Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F353 1.18e-09 62 34 3 106 3 mltF Membrane-bound lytic murein transglycosylase F Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9Z869 5.27e-09 58 25 8 227 1 artJ Probable ABC transporter arginine-binding protein ArtJ Chlamydia pneumoniae
Q4KHS7 5.7e-09 60 24 9 266 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5E750 6.43e-09 59 27 10 212 3 mltF Membrane-bound lytic murein transglycosylase F Aliivibrio fischeri (strain ATCC 700601 / ES114)
A8ZWR8 7.91e-09 59 25 8 261 3 mltF Membrane-bound lytic murein transglycosylase F Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
P39906 1.13e-08 58 24 6 215 3 aabA Amino-acid-binding protein AabA Dichelobacter nodosus
B1JDH3 3.18e-08 57 25 9 260 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas putida (strain W619)
P42400 5.26e-08 56 24 7 250 1 yckB Probable ABC transporter extracellular-binding protein YckB Bacillus subtilis (strain 168)
B0KRE9 5.31e-08 57 23 8 260 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas putida (strain GB-1)
P35120 7.47e-08 55 26 5 200 1 nocT Nopaline-binding periplasmic protein Agrobacterium fabrum (strain C58 / ATCC 33970)
A5VZC8 8.85e-08 56 24 8 243 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88P17 1.22e-07 55 24 8 243 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1I5L3 1.24e-07 55 23 8 260 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas entomophila (strain L48)
Q3KHL5 2.07e-07 55 24 10 261 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas fluorescens (strain Pf0-1)
P55659 2.18e-07 54 28 4 149 3 NGR_a01540 Probable amino-acid ABC transporter periplasmic-binding protein y4tE Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O84385 3.54e-07 53 24 8 217 1 artJ Probable ABC transporter arginine-binding protein ArtJ Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P0A4F8 5.31e-07 53 31 3 119 1 occT Octopine-binding periplasmic protein Rhizobium radiobacter
P0A4F9 5.31e-07 53 31 3 119 3 occT Octopine-binding periplasmic protein Agrobacterium tumefaciens (strain Ach5)
P54952 5.74e-07 53 20 6 240 1 yxeM Probable amino-acid-binding protein YxeM Bacillus subtilis (strain 168)
Q5QWY4 5.79e-07 53 28 4 142 3 mltF Membrane-bound lytic murein transglycosylase F Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B2VEB4 5.93e-07 53 26 10 215 3 mltF Membrane-bound lytic murein transglycosylase F Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MSG2 9.59e-07 53 27 4 134 3 mltF Membrane-bound lytic murein transglycosylase F Vibrio campbellii (strain ATCC BAA-1116)
Q87RW1 1.58e-06 52 27 5 143 3 mltF Membrane-bound lytic murein transglycosylase F Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q886W7 2.38e-06 52 23 9 267 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P72298 2.63e-06 51 32 1 94 3 occT Octopine-binding periplasmic protein Rhizobium meliloti
Q21KP0 4.05e-06 51 30 4 116 3 mltF Membrane-bound lytic murein transglycosylase F Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2Y6L9 6.11e-06 50 23 7 226 3 mltF Membrane-bound lytic murein transglycosylase F Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q02RN8 8.1e-06 50 25 11 267 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas aeruginosa (strain UCBPP-PA14)
A4SNZ5 1.06e-05 50 31 8 167 3 mltF Membrane-bound lytic murein transglycosylase F Aeromonas salmonicida (strain A449)
Q48LX4 2.41e-05 48 22 9 267 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9HXN1 3.69e-05 48 24 10 267 1 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0KJ50 3.96e-05 48 28 5 146 3 mltF Membrane-bound lytic murein transglycosylase F Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q6LU25 4.01e-05 48 26 7 182 3 mltF Membrane-bound lytic murein transglycosylase F Photobacterium profundum (strain SS9)
Q0HKV0 5.63e-05 47 33 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella sp. (strain MR-4)
Q0HX48 6.22e-05 47 33 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella sp. (strain MR-7)
A0KUK5 6.33e-05 47 33 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella sp. (strain ANA-3)
Q085S2 7.36e-05 47 28 6 153 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella frigidimarina (strain NCIMB 400)
A9KWW4 7.63e-05 47 32 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella baltica (strain OS195)
A6WQN7 7.63e-05 47 32 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella baltica (strain OS185)
A3D6V0 7.63e-05 47 32 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1RHR2 8.44e-05 47 32 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella sp. (strain W3-18-1)
A4Y8T1 8.44e-05 47 32 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q7MN72 0.000105 47 31 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Vibrio vulnificus (strain YJ016)
Q8DF80 0.000105 47 31 4 109 3 mltF Membrane-bound lytic murein transglycosylase F Vibrio vulnificus (strain CMCP6)
A6VMD7 0.00014 46 26 3 110 3 mltF Membrane-bound lytic murein transglycosylase F Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q0AQY9 0.000187 46 27 4 136 3 mltF Membrane-bound lytic murein transglycosylase F Maricaulis maris (strain MCS10)
P26762 0.0002 46 21 8 242 3 bvgS Virulence sensor protein BvgS Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8EC56 0.000202 46 27 6 147 3 mltF Membrane-bound lytic murein transglycosylase F Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P40330 0.000202 46 21 8 242 3 bvgS Virulence sensor protein BvgS Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q4ZX03 0.000294 45 23 10 268 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas syringae pv. syringae (strain B728a)
A1JKM2 0.000385 45 26 6 143 3 mltF Membrane-bound lytic murein transglycosylase F Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q30PQ0 0.000441 45 21 5 212 3 mltF Membrane-bound lytic murein transglycosylase F Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q47XX8 0.000445 45 29 2 86 3 mltF Membrane-bound lytic murein transglycosylase F Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A4XXV1 0.000465 45 27 6 136 3 mltF Membrane-bound lytic murein transglycosylase F Pseudomonas mendocina (strain ymp)
Q03445 0.000477 45 28 1 94 1 GluRIA Glutamate receptor 1 Drosophila melanogaster
P16575 0.000578 45 21 8 242 1 bvgS Virulence sensor protein BvgS Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8ZPA3 0.000733 43 21 3 164 1 dalS ABC transporter D-alanine-binding periplasmic protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14325
Feature type CDS
Gene -
Product ABC transporter substrate-binding protein
Location 3179003 - 3179842 (strand: 1)
Length 840 (nucleotides) / 279 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1638
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00497 Bacterial extracellular solute-binding proteins, family 3

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0834 Amino acid transport and metabolism (E)
Signal transduction mechanisms (T)		 ET ABC-type amino acid transport/signal transduction system, periplasmic component/domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02030 polar amino acid transport system substrate-binding protein - -

Protein Sequence

MKLRVLATALIAGSVLFSGLAKADKLDDIKQAGVVRIAIFDSNPPFGFIDPQTKKLAGYDADIANEIAKDLGVKLELRPTNPANRIPLLSAKKVDLIAANFTITEERAKQVDFSVPYFATGQKFIARKGVLTSPEQIASLRIGADKGTVQEITLRERYPETKVISYDDTPLAFAALRNGNVQAITQDDAKLVGLLANLPEKIKADFEISPFSITREYQAVAAAKGEQRLINEINNTLLRLEKEGKADEIYNRWFGPDTKSAQPRGDFKFAPLSEQAPQS

Flanking regions ( +/- flanking 50bp)

ATAGCGTGATAGGCAACATAACAATGAGAATACTTTTTTTGGGGTGAATAATGAAATTACGTGTTTTGGCAACGGCATTAATTGCTGGCTCAGTGCTTTTTTCTGGTCTGGCAAAAGCCGATAAATTAGACGATATAAAACAGGCAGGTGTGGTACGCATTGCTATTTTTGATAGTAACCCACCGTTTGGTTTTATCGATCCACAAACCAAAAAATTGGCAGGTTATGATGCAGATATTGCGAATGAAATTGCCAAAGATCTCGGGGTAAAATTGGAATTACGTCCAACTAACCCAGCTAACCGTATTCCACTACTTAGCGCCAAAAAAGTCGATTTAATTGCCGCCAACTTCACCATTACCGAAGAGCGAGCAAAACAAGTCGATTTCTCTGTACCTTATTTTGCTACTGGACAGAAATTTATCGCGCGCAAAGGCGTATTAACCAGCCCTGAGCAAATTGCGTCATTACGCATTGGGGCTGACAAAGGCACCGTACAGGAAATTACCTTACGTGAACGCTATCCTGAAACTAAAGTCATCTCCTATGACGATACCCCTCTTGCGTTTGCCGCATTACGCAATGGCAATGTACAAGCGATAACCCAAGATGATGCTAAATTAGTAGGGTTATTAGCTAATTTACCTGAGAAAATCAAAGCTGATTTTGAAATATCGCCCTTTAGTATTACACGAGAATATCAAGCCGTTGCCGCAGCTAAAGGTGAACAGCGTTTAATTAACGAGATTAATAACACGCTATTAAGATTAGAGAAAGAAGGCAAAGCAGACGAAATTTATAATCGTTGGTTTGGCCCTGATACTAAGTCCGCTCAACCTCGTGGTGACTTTAAGTTTGCCCCACTTTCTGAGCAAGCGCCTCAATCCTAATGGTAGAGCAAATAACGACTTAATTTATCGCGATGATTTATTGATAAAAC