Homologs in group_1717

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11980 FBDBKF_11980 83.3 Morganella morganii S1 dppC dipeptide ABC transporter permease DppC
EHELCC_14325 EHELCC_14325 83.3 Morganella morganii S2 dppC dipeptide ABC transporter permease DppC
NLDBIP_15420 NLDBIP_15420 83.3 Morganella morganii S4 dppC dipeptide ABC transporter permease DppC
LHKJJB_15190 LHKJJB_15190 83.3 Morganella morganii S3 dppC dipeptide ABC transporter permease DppC
HKOGLL_14310 HKOGLL_14310 83.3 Morganella morganii S5 dppC dipeptide ABC transporter permease DppC
F4V73_RS14675 F4V73_RS14675 81.0 Morganella psychrotolerans dppC dipeptide ABC transporter permease DppC

Distribution of the homologs in the orthogroup group_1717

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1717

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEG1 3.28e-155 438 84 0 300 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 3.28e-155 438 84 0 300 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 3.28e-155 438 84 0 300 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
P51000 8.51e-130 374 62 0 286 3 dppC Dipeptide transport system permease protein DppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H2ZFV0 3.12e-123 357 63 0 284 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
P94312 1.32e-90 274 50 1 298 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P42063 2.24e-73 230 44 4 285 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)
Q6D3B2 5.02e-67 214 40 1 293 3 gsiD Glutathione transport system permease protein GsiD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P77463 1.31e-66 213 44 2 265 1 ddpC Probable D,D-dipeptide transport system permease protein DdpC Escherichia coli (strain K12)
Q83S25 1.62e-66 213 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri
P0C2L2 1.62e-66 213 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri serotype 5b (strain 8401)
P75799 2.79e-66 212 38 1 295 1 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain K12)
Q3Z3V1 3.42e-66 212 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Shigella sonnei (strain Ss046)
Q323W2 3.42e-66 212 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Shigella boydii serotype 4 (strain Sb227)
Q8X6V6 3.42e-66 212 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O157:H7
Q8FJK8 3.46e-66 212 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJL6 3.46e-66 212 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q32IB8 1.21e-65 211 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Shigella dysenteriae serotype 1 (strain Sd197)
P0AGH7 2.06e-65 210 39 0 286 3 sapC Peptide transport system permease protein SapC Shigella flexneri
P0AGH5 2.06e-65 210 39 0 286 1 sapC Putrescine export system permease protein SapC Escherichia coli (strain K12)
P0AGH6 2.06e-65 210 39 0 286 3 sapC Peptide transport system permease protein SapC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1RE93 2.56e-65 210 37 1 295 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain UTI89 / UPEC)
A1A971 2.56e-65 210 37 1 295 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O1:K1 / APEC
P0A2J5 4.68e-65 209 40 0 286 2 sapC Peptide transport system permease protein SapC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J6 4.68e-65 209 40 0 286 3 sapC Peptide transport system permease protein SapC Salmonella typhi
Q8FUW9 2.05e-60 197 42 2 243 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
Q8YDG8 2.29e-60 197 42 2 243 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 2.29e-60 197 42 2 243 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 2.29e-60 197 42 2 243 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
Q7CQV4 2.58e-58 192 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF88 2.58e-58 192 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhi
Q5PGP6 2.58e-58 192 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RA9 2.58e-58 192 38 1 295 3 gsiD Glutathione transport system permease protein GsiD Salmonella choleraesuis (strain SC-B67)
P26904 1.81e-56 187 38 3 282 2 dppC Dipeptide transport system permease protein DppC Bacillus subtilis (strain 168)
P45287 2.38e-55 184 37 0 279 3 sapC Peptide transport system permease protein SapC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8FWN9 1.37e-49 169 36 2 291 3 BRA0407 Putative peptide permease protein BRA0407/BS1330_II0404 Brucella suis biovar 1 (strain 1330)
P24139 3.27e-49 168 37 1 275 1 oppC Oligopeptide transport system permease protein OppC Bacillus subtilis (strain 168)
A5VU89 7.59e-49 167 36 2 291 3 BOV_A0350 Putative peptide permease protein BOV_A0350 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YBN8 1.05e-48 167 36 2 291 3 BMEII0861 Putative peptide permease protein BMEII0861 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YK65 1.05e-48 167 36 2 291 3 BAB2_0815 Putative peptide permease protein BAB2_0815 Brucella abortus (strain 2308)
Q577J7 1.05e-48 167 36 2 291 3 BruAb2_0794 Putative peptide permease protein BruAb2_0794 Brucella abortus biovar 1 (strain 9-941)
Q7A0Y0 2.59e-46 160 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MW2)
Q6G9H9 2.59e-46 160 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MSSA476)
Q5HG39 2.59e-46 160 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain COL)
Q2FYQ6 2.59e-46 160 37 1 228 1 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH56 2.59e-46 160 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain USA300)
Q7A5Q7 3.46e-46 160 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain N315)
Q99UA1 3.46e-46 160 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GH26 6.44e-46 159 38 3 229 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MRSA252)
Q2YXY8 6.65e-46 159 36 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q53192 1.92e-45 158 39 1 225 3 NGR_a01420 Probable peptide ABC transporter permease protein y4tQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q2FVE9 1.03e-44 156 34 1 273 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3JU73 1.47e-44 156 34 1 273 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0AFA9 6.9e-44 154 41 4 221 1 nikC Nickel transport system permease protein NikC Escherichia coli (strain K12)
P0AFB0 6.9e-44 154 41 4 221 3 nikC Nickel transport system permease protein NikC Escherichia coli O157:H7
P45053 9.49e-42 149 34 2 278 3 oppC Oligopeptide transport system permease protein OppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P08006 9.71e-40 144 32 1 278 1 oppC Oligopeptide transport system permease protein OppC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFH6 8.8e-38 139 33 1 278 1 oppC Oligopeptide transport system permease protein OppC Escherichia coli (strain K12)
P0AFH7 8.8e-38 139 33 1 278 3 oppC Oligopeptide transport system permease protein OppC Escherichia coli O157:H7
P66965 3.72e-34 129 33 5 255 3 BQ2027_MB1313C Putative peptide transport permease protein Mb1313c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ9 3.72e-34 129 33 5 255 1 Rv1282c Putative peptide transport permease protein Rv1282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ8 3.72e-34 129 33 5 255 3 MT1319 Putative peptide transport permease protein MT1319 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4P0 7.01e-34 128 33 8 280 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N9 1.09e-33 127 33 8 280 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
A2RI76 6.38e-31 121 27 5 328 1 dppC Dipeptide transport system permease protein DppC Lactococcus lactis subsp. cremoris (strain MG1363)
Q7D203 1.48e-30 121 33 2 218 3 yejE Peptidoglycan transport system permease protein YejE Agrobacterium fabrum (strain C58 / ATCC 33970)
P33915 2.19e-24 103 30 4 221 1 yejE Inner membrane ABC transporter permease protein YejE Escherichia coli (strain K12)
P0A4N0 1.95e-17 84 23 5 303 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M9 1.95e-17 84 23 5 303 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P47324 4.08e-13 72 28 9 259 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75553 7.82e-12 68 28 9 259 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A0A0H3K104 5.07e-06 50 25 9 264 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FVE8 5.6e-06 50 29 5 171 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain NCTC 8325 / PS 47)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14055
Feature type CDS
Gene dppC
Product dipeptide ABC transporter permease DppC
Location 3120422 - 3121324 (strand: -1)
Length 903 (nucleotides) / 300 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1717
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF12911 N-terminal TM domain of oligopeptide transport permease C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1173 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)		 EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12370 dipeptide transport system permease protein ABC transporters -

Protein Sequence

MAENNVTPVISAPVPMTPFQEFWHYFKQNKGAVVGLIYIVIMLLIAALAGVLAPHAPNEQFREFLLTPPVWQEGGSWSFILGTDDVGRDILSRLMYGARLSLLVGCIVVILSLILGIILGLMAGYFGGIVDIAIMRVVDIMLALPSLLLALVLVAIFGPSIINASIALTFVALPHYVRLTRAAVLTEINRDYVVASRVAGAGSIRQMFINILPNCLAPLIVQASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFTQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ

Flanking regions ( +/- flanking 50bp)

ATATGGCATTGTTAACCCACGTATCCGTCATAAGAAATAAGGAGTGCATCATGGCTGAAAATAACGTAACACCGGTCATTAGTGCACCGGTGCCAATGACCCCCTTTCAAGAGTTTTGGCACTATTTCAAACAAAATAAAGGGGCGGTTGTTGGCTTAATTTATATTGTCATTATGCTGTTGATAGCTGCCCTTGCAGGCGTTTTAGCGCCTCATGCACCTAATGAGCAGTTTCGTGAGTTTCTTCTAACGCCCCCTGTATGGCAAGAAGGAGGAAGCTGGAGTTTTATTTTAGGTACTGATGATGTTGGGCGGGATATTCTCTCTCGCTTAATGTATGGTGCGCGTCTTTCATTACTCGTTGGTTGCATTGTCGTTATACTTTCACTGATTTTAGGCATTATTTTAGGTTTAATGGCCGGCTATTTTGGTGGCATCGTTGATATCGCCATTATGCGCGTAGTCGATATTATGCTGGCATTACCCAGTCTTTTATTAGCATTAGTGTTAGTGGCTATTTTTGGGCCTTCGATTATTAATGCTTCAATCGCTTTAACCTTTGTTGCCCTACCTCATTATGTTCGACTGACGCGTGCGGCAGTGTTAACAGAAATTAACCGTGATTATGTTGTGGCGTCTCGTGTTGCGGGAGCAGGCTCTATACGCCAAATGTTTATCAATATCTTGCCTAACTGCCTTGCTCCTTTAATTGTGCAAGCCTCTTTAGGTTTTTCTAATGCCATCTTAGATATGGCTGCCTTAGGTTTTTTGGGAATGGGCGCACAGCCACCGACACCAGAATGGGGAACCATGTTATCTGATGTACTGCAATTTACCCAAAGTGCATGGTGGGTAGTGACTTTTCCGGGGTTAGCTATTTTGTTGACGGTTTTAGCCTTTAACTTAATGGGTGACGGTCTACGAGATGCACTCGATCCAAAATTAAAGCAGTAACGGAGTAAGAGCATGGCGTTATTAAATATAAATCAATTATCAGTTCACTT