Homologs in group_1717

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11980 FBDBKF_11980 100.0 Morganella morganii S1 dppC dipeptide ABC transporter permease DppC
NLDBIP_15420 NLDBIP_15420 100.0 Morganella morganii S4 dppC dipeptide ABC transporter permease DppC
LHKJJB_15190 LHKJJB_15190 100.0 Morganella morganii S3 dppC dipeptide ABC transporter permease DppC
HKOGLL_14310 HKOGLL_14310 100.0 Morganella morganii S5 dppC dipeptide ABC transporter permease DppC
F4V73_RS14675 F4V73_RS14675 94.0 Morganella psychrotolerans dppC dipeptide ABC transporter permease DppC
PMI_RS14055 PMI_RS14055 83.3 Proteus mirabilis HI4320 dppC dipeptide ABC transporter permease DppC

Distribution of the homologs in the orthogroup group_1717

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1717

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEG1 2.98e-152 431 81 0 300 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 2.98e-152 431 81 0 300 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 2.98e-152 431 81 0 300 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
P51000 2.07e-128 370 60 1 296 3 dppC Dipeptide transport system permease protein DppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H2ZFV0 4.5e-124 359 64 0 284 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
P94312 1.47e-94 285 52 1 285 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P42063 2.32e-77 241 44 5 294 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)
Q83S25 1.13e-69 221 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri
P0C2L2 1.13e-69 221 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri serotype 5b (strain 8401)
P75799 2.26e-69 220 40 2 284 1 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain K12)
Q8FJK8 2.33e-69 220 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJL6 2.33e-69 220 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z3V1 3.23e-69 220 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Shigella sonnei (strain Ss046)
Q323W2 3.23e-69 220 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Shigella boydii serotype 4 (strain Sb227)
Q8X6V6 3.23e-69 220 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O157:H7
P77463 7.28e-69 219 45 2 261 1 ddpC Probable D,D-dipeptide transport system permease protein DdpC Escherichia coli (strain K12)
Q32IB8 1.1e-68 218 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Shigella dysenteriae serotype 1 (strain Sd197)
Q1RE93 2.03e-68 218 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain UTI89 / UPEC)
A1A971 2.03e-68 218 40 2 284 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O1:K1 / APEC
Q6D3B2 2.43e-68 218 41 1 292 3 gsiD Glutathione transport system permease protein GsiD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P0A2J5 1.25e-62 202 40 0 287 2 sapC Peptide transport system permease protein SapC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J6 1.25e-62 202 40 0 287 3 sapC Peptide transport system permease protein SapC Salmonella typhi
Q7CQV4 1.68e-62 202 41 1 268 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF88 1.68e-62 202 41 1 268 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhi
Q5PGP6 1.68e-62 202 41 1 268 3 gsiD Glutathione transport system permease protein GsiD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RA9 1.68e-62 202 41 1 268 3 gsiD Glutathione transport system permease protein GsiD Salmonella choleraesuis (strain SC-B67)
P0AGH7 2.96e-62 202 39 0 287 3 sapC Peptide transport system permease protein SapC Shigella flexneri
P0AGH5 2.96e-62 202 39 0 287 1 sapC Putrescine export system permease protein SapC Escherichia coli (strain K12)
P0AGH6 2.96e-62 202 39 0 287 3 sapC Peptide transport system permease protein SapC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8YDG8 3e-60 196 41 2 272 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 3e-60 196 41 2 272 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 3e-60 196 41 2 272 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
Q8FUW9 1.54e-59 195 41 2 250 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
P26904 6.89e-58 191 37 4 302 2 dppC Dipeptide transport system permease protein DppC Bacillus subtilis (strain 168)
P45287 5.79e-54 180 37 0 275 3 sapC Peptide transport system permease protein SapC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24139 1.94e-51 174 37 1 289 1 oppC Oligopeptide transport system permease protein OppC Bacillus subtilis (strain 168)
Q8FWN9 5.06e-50 170 36 2 289 3 BRA0407 Putative peptide permease protein BRA0407/BS1330_II0404 Brucella suis biovar 1 (strain 1330)
A5VU89 3.09e-49 168 36 2 289 3 BOV_A0350 Putative peptide permease protein BOV_A0350 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YBN8 4.35e-49 168 36 2 289 3 BMEII0861 Putative peptide permease protein BMEII0861 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YK65 4.35e-49 168 36 2 289 3 BAB2_0815 Putative peptide permease protein BAB2_0815 Brucella abortus (strain 2308)
Q577J7 4.35e-49 168 36 2 289 3 BruAb2_0794 Putative peptide permease protein BruAb2_0794 Brucella abortus biovar 1 (strain 9-941)
Q6GH26 6.87e-48 164 37 3 229 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MRSA252)
Q7A0Y0 1.24e-47 163 37 3 229 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MW2)
Q6G9H9 1.24e-47 163 37 3 229 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MSSA476)
Q5HG39 1.24e-47 163 37 3 229 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain COL)
Q2FYQ6 1.24e-47 163 37 3 229 1 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH56 1.24e-47 163 37 3 229 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain USA300)
Q7A5Q7 1.34e-47 163 37 3 229 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain N315)
Q99UA1 1.34e-47 163 37 3 229 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YXY8 2.51e-47 162 37 3 229 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FVE9 4.91e-47 162 34 1 273 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3JU73 7.14e-47 162 34 1 273 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q53192 5.44e-46 159 40 1 220 3 NGR_a01420 Probable peptide ABC transporter permease protein y4tQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0AFA9 1.23e-42 150 40 2 222 1 nikC Nickel transport system permease protein NikC Escherichia coli (strain K12)
P0AFB0 1.23e-42 150 40 2 222 3 nikC Nickel transport system permease protein NikC Escherichia coli O157:H7
P45053 1.95e-42 151 34 5 283 3 oppC Oligopeptide transport system permease protein OppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P08006 3.51e-40 145 31 3 302 1 oppC Oligopeptide transport system permease protein OppC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFH6 1.54e-38 140 32 3 302 1 oppC Oligopeptide transport system permease protein OppC Escherichia coli (strain K12)
P0AFH7 1.54e-38 140 32 3 302 3 oppC Oligopeptide transport system permease protein OppC Escherichia coli O157:H7
P66965 1.49e-36 135 33 4 257 3 BQ2027_MB1313C Putative peptide transport permease protein Mb1313c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ9 1.49e-36 135 33 4 257 1 Rv1282c Putative peptide transport permease protein Rv1282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ8 1.49e-36 135 33 4 257 3 MT1319 Putative peptide transport permease protein MT1319 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4P0 8.56e-35 130 32 9 300 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N9 1.39e-34 130 32 9 300 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
A2RI76 2.28e-30 120 26 3 330 1 dppC Dipeptide transport system permease protein DppC Lactococcus lactis subsp. cremoris (strain MG1363)
Q7D203 6.21e-30 119 33 2 218 3 yejE Peptidoglycan transport system permease protein YejE Agrobacterium fabrum (strain C58 / ATCC 33970)
P33915 4.18e-22 97 29 2 221 1 yejE Inner membrane ABC transporter permease protein YejE Escherichia coli (strain K12)
P0A4N0 2.84e-15 78 22 5 293 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M9 2.84e-15 78 22 5 293 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P47324 1.71e-11 67 27 8 245 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75553 1.85e-10 64 28 8 235 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_14325
Feature type CDS
Gene dppC
Product dipeptide ABC transporter permease DppC
Location 89350 - 90252 (strand: 1)
Length 903 (nucleotides) / 300 (amino acids)

Contig

Accession ZDB_224
Length 134704 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1717
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF12911 N-terminal TM domain of oligopeptide transport permease C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1173 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)		 EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12370 dipeptide transport system permease protein ABC transporters -

Protein Sequence

MSETTNTTVTRAPEPLSPLREFWHYFRRNKGALIGLIYILLMLLIAVFAPLLAPHLPDEQFRDHLLQPPVWQEGGSWQFILGTDDIGRDILSRLMYGARLSLLVGCLVVALSLLLGVVIGLAAGYFGGWVDALIMRIVDIMLALPSLLLALVLVAIFGPSIVNASLALTFVALPHYIRLTRAAVLTEVSRDYVTASAVAGAGPVRQMFVNILPNCLAPLIVQASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFTQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ

Flanking regions ( +/- flanking 50bp)

ACGGCGTCGTTAACCCGCGGATCCGTCATAAAAAATAACAGGAGCGCACAATGTCTGAGACGACAAATACTACCGTGACCCGCGCGCCTGAGCCGCTTTCCCCGCTGCGCGAATTCTGGCACTACTTCCGGCGCAACAAAGGCGCGCTGATCGGCCTGATCTATATTCTGCTGATGCTGCTGATCGCCGTTTTTGCCCCGCTGCTCGCCCCGCATCTGCCGGATGAGCAGTTCCGTGATCATTTATTACAGCCGCCGGTCTGGCAGGAAGGCGGCTCATGGCAGTTTATTCTCGGTACTGATGATATCGGCCGCGATATTCTGTCGCGCCTGATGTACGGCGCACGGCTTTCACTGCTGGTCGGTTGTCTGGTGGTAGCGCTGTCGCTGCTGCTGGGGGTGGTGATTGGCCTCGCTGCCGGGTATTTCGGCGGCTGGGTTGATGCCCTGATCATGCGTATCGTCGATATCATGCTGGCACTGCCGAGCCTGCTGCTGGCACTGGTGCTGGTGGCAATTTTCGGTCCGTCGATTGTTAATGCCTCGCTGGCGCTGACTTTCGTGGCACTGCCGCACTATATCCGTCTGACCCGCGCGGCGGTGCTGACGGAAGTGAGCCGCGACTATGTGACCGCTTCTGCGGTGGCGGGCGCAGGCCCGGTGCGCCAGATGTTTGTCAATATTCTGCCGAACTGCCTGGCGCCGCTGATTGTGCAGGCATCTCTGGGTTTTTCCAACGCTATTCTGGACATGGCTGCATTAGGTTTCCTCGGGATGGGCGCACAGCCGCCGACACCGGAGTGGGGAACCATGCTGTCCGATGTTTTACAGTTTACGCAGAGCGCATGGTGGGTGGTGACCTTCCCGGGCCTGGCGATTTTACTGACAGTACTGGCGTTTAACCTGATGGGCGACGGATTGCGTGATGCCCTTGATCCTAAGCTTAAGCAGTAGAGGTGCAGACATGGCGTTATTAACAGTTGATAAATTATCTGTTCACTTCG