Homologs in group_1701

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11860 FBDBKF_11860 74.5 Morganella morganii S1 ppiA peptidylprolyl isomerase A
EHELCC_14445 EHELCC_14445 74.5 Morganella morganii S2 ppiA peptidylprolyl isomerase A
NLDBIP_15540 NLDBIP_15540 74.5 Morganella morganii S4 ppiA peptidylprolyl isomerase A
LHKJJB_15070 LHKJJB_15070 74.5 Morganella morganii S3 ppiA peptidylprolyl isomerase A
HKOGLL_14190 HKOGLL_14190 74.5 Morganella morganii S5 ppiA peptidylprolyl isomerase A
F4V73_RS14790 F4V73_RS14790 70.7 Morganella psychrotolerans ppiA peptidylprolyl isomerase A

Distribution of the homologs in the orthogroup group_1701

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1701

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O53021 1.64e-100 291 70 0 190 3 rotA Peptidyl-prolyl cis-trans isomerase A Dickeya dadantii (strain 3937)
P0AFL3 1.21e-94 276 69 1 189 1 ppiA Peptidyl-prolyl cis-trans isomerase A Escherichia coli (strain K12)
P0AFL4 1.21e-94 276 69 1 189 3 ppiA Peptidyl-prolyl cis-trans isomerase A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFL5 1.21e-94 276 69 1 189 3 ppiA Peptidyl-prolyl cis-trans isomerase A Escherichia coli O157:H7
P20753 7.45e-90 264 75 0 163 3 ppiA Peptidyl-prolyl cis-trans isomerase A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q59641 7.49e-75 226 60 2 188 3 ppiA Peptidyl-prolyl cis-trans isomerase A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P42693 2.16e-70 214 57 1 187 3 rotA Peptidyl-prolyl cis-trans isomerase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P83221 1.72e-59 186 58 1 162 1 cyp18 Peptidyl-prolyl cis-trans isomerase cyp18 Streptomyces antibioticus
P44499 3.89e-59 185 55 1 167 3 ppiB Peptidyl-prolyl cis-trans isomerase B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23869 3.19e-53 170 54 1 161 1 ppiB Peptidyl-prolyl cis-trans isomerase B Escherichia coli (strain K12)
Q8G0J9 2.06e-22 92 36 5 181 3 ppi Probable peptidyl-prolyl cis-trans isomerase Brucella suis biovar 1 (strain 1330)
Q8YHB5 2.06e-22 92 36 5 181 3 ppi Probable peptidyl-prolyl cis-trans isomerase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P72704 3.24e-22 93 35 4 170 3 sll0227 Probable peptidyl-prolyl cis-trans isomerase sll0227 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q57D43 5.41e-22 91 35 5 181 3 ppi Probable peptidyl-prolyl cis-trans isomerase Brucella abortus biovar 1 (strain 9-941)
Q2YPY5 5.41e-22 91 35 5 181 3 ppi Probable peptidyl-prolyl cis-trans isomerase Brucella abortus (strain 2308)
Q4I1Y1 4.44e-21 88 33 4 165 3 CYP1 Peptidyl-prolyl cis-trans isomerase-like 1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q9D0W5 6.25e-21 87 39 7 163 1 Ppil1 Peptidyl-prolyl cis-trans isomerase-like 1 Mus musculus
Q4WCR3 1.21e-20 87 35 6 160 3 cyp1 Peptidyl-prolyl cis-trans isomerase-like 1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9Y3C6 2e-20 86 38 7 163 1 PPIL1 Peptidyl-prolyl cis-trans isomerase-like 1 Homo sapiens
Q5E992 2e-20 86 38 7 163 2 PPIL1 Peptidyl-prolyl cis-trans isomerase-like 1 Bos taurus
Q8X191 2.93e-20 85 34 4 165 3 cypC Peptidyl-prolyl cis-trans isomerase-like 1 Aspergillus niger
Q8W4D0 5.76e-20 90 38 6 158 1 CYP71 Peptidyl-prolyl cis-trans isomerase CYP71 Arabidopsis thaliana
Q5ASQ0 6.51e-20 85 34 4 164 3 cyp1 Peptidyl-prolyl cis-trans isomerase-like 1 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q7SF72 1.39e-19 84 35 6 166 3 ppi-1 Peptidyl-prolyl cis-trans isomerase-like 1 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P0CP86 1.97e-19 84 35 6 165 3 CYP10 Peptidyl-prolyl cis-trans isomerase-like 3 Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP87 1.97e-19 84 35 6 165 3 CYP10 Peptidyl-prolyl cis-trans isomerase-like 3 Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q2U6U0 2.54e-19 83 33 4 165 3 cyp1 Peptidyl-prolyl cis-trans isomerase-like 1 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P0CP84 2.84e-19 83 34 6 169 3 CYP1 Peptidyl-prolyl cis-trans isomerase-like 1 Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP85 2.84e-19 83 34 6 169 3 CYP1 Peptidyl-prolyl cis-trans isomerase-like 1 Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
O25982 4.16e-19 82 37 5 139 3 ppiA Peptidyl-prolyl cis-trans isomerase Helicobacter pylori (strain ATCC 700392 / 26695)
Q8CEC6 1.35e-18 85 36 5 154 1 Ppwd1 Peptidylprolyl isomerase domain and WD repeat-containing protein 1 Mus musculus
Q29RZ2 1.45e-18 85 36 5 154 2 PPWD1 Peptidylprolyl isomerase domain and WD repeat-containing protein 1 Bos taurus
P52012 1.83e-18 85 35 6 164 1 cyn-4 Peptidyl-prolyl cis-trans isomerase 4 Caenorhabditis elegans
P0C1I4 3.27e-18 80 36 3 139 3 cyp3 Peptidyl-prolyl cis-trans isomerase-like 1 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q5NVL7 4.54e-18 84 36 5 154 2 PPWD1 Peptidylprolyl isomerase domain and WD repeat-containing protein 1 Pongo abelii
Q09928 4.91e-18 84 34 5 158 2 cyp8 Peptidyl-prolyl cis-trans isomerase cyp8 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P87051 4.95e-18 80 31 4 158 1 ppi1 Peptidyl-prolyl cis-trans isomerase ppi1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q96BP3 4.95e-18 84 36 5 154 1 PPWD1 Peptidylprolyl isomerase domain and WD repeat-containing protein 1 Homo sapiens
Q54E95 9.18e-18 79 32 5 165 3 ppil3 Peptidyl-prolyl cis-trans isomerase-like 3 Dictyostelium discoideum
Q9ZJH5 1.45e-17 79 37 6 139 3 ppiA Peptidyl-prolyl cis-trans isomerase Helicobacter pylori (strain J99 / ATCC 700824)
Q49W93 2.24e-17 79 32 8 187 3 SSP1821 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0CP90 4.57e-17 81 32 7 164 3 CYP8 Peptidyl-prolyl cis-trans isomerase-like 2 Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP91 4.57e-17 81 32 7 164 3 CYP8 Peptidyl-prolyl cis-trans isomerase-like 2 Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
P0C1J1 6.98e-17 80 34 6 171 3 cyp14 Peptidyl-prolyl cis-trans isomerase-like 2 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q9SIH1 7.26e-17 77 29 4 161 2 CYP18-2 Peptidyl-prolyl cis-trans isomerase CYP18-2 Arabidopsis thaliana
P52017 7.62e-17 77 33 5 157 2 cyn-10 Peptidyl-prolyl cis-trans isomerase 10 Caenorhabditis elegans
O93826 1.07e-16 78 41 10 155 2 CPR2 Peptidyl-prolyl cis-trans isomerase B Arthroderma benhamiae
D4AY02 1.07e-16 78 41 10 155 1 ARB_01071 Probable peptidyl-prolyl cis-trans isomerase ARB_01071 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
Q9D6L8 1.08e-16 76 31 5 158 1 Ppil3 Peptidyl-prolyl cis-trans isomerase-like 3 Mus musculus
Q9NI62 1.19e-16 76 33 4 161 1 cypE Peptidyl-prolyl cis-trans isomerase cypE Dictyostelium discoideum
Q812D3 1.47e-16 76 31 5 158 2 Ppil3 Peptidyl-prolyl cis-trans isomerase-like 3 Rattus norvegicus
Q9H2H8 2.29e-16 75 31 5 158 1 PPIL3 Peptidyl-prolyl cis-trans isomerase-like 3 Homo sapiens
P0C1I0 3.15e-16 76 35 11 202 3 cyp9 Peptidyl-prolyl cis-trans isomerase B2 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q8SRE1 3.44e-16 75 35 6 154 1 CPR1 Peptidyl-prolyl cis-trans isomerase Encephalitozoon cuniculi (strain GB-M1)
Q5ZLV2 3.56e-16 75 31 6 163 2 PPIL3 Peptidyl-prolyl cis-trans isomerase-like 3 Gallus gallus
Q8LDR3 5.42e-16 76 32 6 189 2 CYP23 Peptidyl-prolyl cis-trans isomerase CYP23 Arabidopsis thaliana
Q9LPC7 5.66e-16 74 34 5 147 2 CYP18-1 Peptidyl-prolyl cis-trans isomerase CYP18-1 Arabidopsis thaliana
Q4IBK5 1.05e-15 77 29 6 201 3 CYP8 Peptidyl-prolyl cis-trans isomerase-like 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q5B4R3 1.08e-15 75 41 9 150 3 cpr2 Peptidyl-prolyl cis-trans isomerase B Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P0C1H9 1.1e-15 75 38 7 163 3 cyp8 Peptidyl-prolyl cis-trans isomerase B1 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
O66105 1.42e-15 74 37 7 153 1 ppiB Probable peptidyl-prolyl cis-trans isomerase Treponema pallidum (strain Nichols)
P0C1J2 7.71e-15 75 38 5 126 3 cwc27 Peptidyl-prolyl isomerase cwc27 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
O42941 8.15e-15 75 33 7 176 1 cyp7 Peptidylprolyl isomerase cyp7 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q4R713 9.36e-15 74 37 4 125 2 CWC27 Spliceosome-associated protein CWC27 homolog Macaca fascicularis
Q5R7W3 1.02e-14 74 37 4 125 2 CWC27 Spliceosome-associated protein CWC27 homolog Pongo abelii
P24367 1.12e-14 72 37 11 170 2 PPIB Peptidyl-prolyl cis-trans isomerase B Gallus gallus
Q6UX04 1.12e-14 74 37 4 125 1 CWC27 Spliceosome-associated protein CWC27 homolog Homo sapiens
P52009 1.27e-14 72 32 9 200 2 cyn-1 Peptidyl-prolyl cis-trans isomerase 1 Caenorhabditis elegans
P0CP92 1.56e-14 74 36 3 122 3 CWC27 Peptidyl-prolyl isomerase CWC27 Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP93 1.56e-14 74 36 3 122 3 CWC27 Peptidyl-prolyl isomerase CWC27 Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
P29820 1.57e-14 70 35 3 137 3 rot Peptidyl-prolyl cis-trans isomerase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q4WP12 1.81e-14 71 37 9 160 3 cpr2 Peptidyl-prolyl cis-trans isomerase B Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q13356 2.14e-14 73 35 4 141 1 PPIL2 RING-type E3 ubiquitin-protein ligase PPIL2 Homo sapiens
O74942 2.69e-14 73 31 6 158 1 cyp9 Peptidyl-prolyl cis-trans isomerase 9 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B3A0R0 3.23e-14 71 35 9 159 1 None Putative peptidyl-prolyl cis-trans isomerase Lottia gigantea
P0C1I5 3.23e-14 70 32 7 177 3 cyp4 Peptidyl-prolyl cis-trans isomerase-like 3 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q9FJX0 4.93e-14 72 30 5 162 2 CYP65 Peptidyl-prolyl cis-trans isomerase CYP65 Arabidopsis thaliana
Q27774 5.26e-14 70 37 9 160 2 None Peptidyl-prolyl cis-trans isomerase B Schistosoma japonicum
P35176 5.89e-14 70 34 11 198 1 CPR5 Peptidyl-prolyl cis-trans isomerase D Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O94273 7.23e-14 70 35 8 164 3 cyp4 Peptidyl-prolyl cis-trans isomerase B Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5AUG9 7.31e-14 72 30 6 175 3 cwc27 Peptidyl-prolyl isomerase cwc27 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q6Q152 8.99e-14 72 32 8 173 1 CYP57 Peptidyl-prolyl cis-trans isomerase CYP57 Arabidopsis thaliana
Q9D787 9.18e-14 72 32 5 162 1 Ppil2 RING-type E3 ubiquitin-protein ligase PPIL2 Mus musculus
P80311 1.38e-13 69 38 10 155 1 PPIB Peptidyl-prolyl cis-trans isomerase B Bos taurus
P0C1J0 1.56e-13 71 34 4 135 3 cyp15 Peptidyl-prolyl cis-trans isomerase cyp15 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q8LDP4 1.93e-13 68 39 9 143 1 CYP19-4 Peptidyl-prolyl cis-trans isomerase CYP19-4 Arabidopsis thaliana
Q4WE62 2.02e-13 71 30 7 175 3 cwc27 Peptidyl-prolyl isomerase cwc27 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q7A1C0 2.02e-13 68 31 7 187 3 MW0836 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus aureus (strain MW2)
Q6GAX2 2.02e-13 68 31 7 187 3 SAS0824 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus aureus (strain MSSA476)
Q6GID4 2.02e-13 68 31 7 187 3 SAR0916 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus aureus (strain MRSA252)
Q7A6I1 2.02e-13 68 31 7 187 1 SA0815 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus aureus (strain N315)
Q99VD4 2.02e-13 68 31 7 187 3 SAV0954 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YWT2 2.02e-13 68 31 7 187 3 SAB0821 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZU9 2.02e-13 68 31 7 187 3 SAOUHSC_00891 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIC1 2.02e-13 68 31 7 187 3 SAUSA300_0857 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus aureus (strain USA300)
Q4P555 3.04e-13 70 36 5 136 3 CYP8 Peptidyl-prolyl cis-trans isomerase-like 2 Ustilago maydis (strain 521 / FGSC 9021)
P21569 3.63e-13 67 36 6 145 2 CYP Peptidyl-prolyl cis-trans isomerase Zea mays
Q26551 3.72e-13 68 36 9 161 2 CYP Peptidyl-prolyl cis-trans isomerase B Schistosoma mansoni
Q3TKY6 4.15e-13 70 37 4 125 1 Cwc27 Spliceosome-associated protein CWC27 homolog Mus musculus
Q7S7Z6 4.54e-13 68 37 9 152 3 cpr2 Peptidyl-prolyl cis-trans isomerase B Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q7ZW86 4.62e-13 70 36 4 125 2 cwc27 Spliceosome-associated protein CWC27 homolog Danio rerio
Q5XIB2 5.12e-13 69 37 4 125 1 Cwc27 Spliceosome-associated protein CWC27 homolog Rattus norvegicus
Q5XAQ1 5.13e-13 69 39 2 101 1 M6_Spy1377 Putative bifunctional phosphatase/peptidyl-prolyl cis-trans isomerase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8L8W5 5.5e-13 68 38 11 160 2 CYP21-2 Peptidyl-prolyl cis-trans isomerase CYP21-2 Arabidopsis thaliana
P24369 6.84e-13 67 36 10 160 1 Ppib Peptidyl-prolyl cis-trans isomerase B Mus musculus
Q5AXT6 7.32e-13 69 28 5 166 3 cyp8 Peptidyl-prolyl cis-trans isomerase-like 2 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P23285 7.79e-13 67 34 6 160 1 CPR2 Peptidyl-prolyl cis-trans isomerase B Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8X166 7.99e-13 67 36 9 161 1 cypB Peptidyl-prolyl cis-trans isomerase B Aspergillus niger
P14851 8.27e-13 66 35 7 138 2 PPIA Peptidyl-prolyl cis-trans isomerase A Cricetulus griseus
Q2UGK2 8.31e-13 67 39 7 134 3 cpr2 Peptidyl-prolyl cis-trans isomerase B Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P17742 9.37e-13 66 35 7 138 1 Ppia Peptidyl-prolyl cis-trans isomerase A Mus musculus
Q5HHD1 1.02e-12 67 30 7 187 3 SACOL0957 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus aureus (strain COL)
P35137 1.09e-12 65 35 6 134 1 ppiB Peptidyl-prolyl cis-trans isomerase B Bacillus subtilis (strain 168)
P24368 1.12e-12 67 36 10 158 1 Ppib Peptidyl-prolyl cis-trans isomerase B Rattus norvegicus
P52014 1.15e-12 66 36 9 155 2 cyn-6 Peptidyl-prolyl cis-trans isomerase 6 Caenorhabditis elegans
P0CP88 1.18e-12 68 34 7 172 3 CYP6 Peptidyl-prolyl cis-trans isomerase-like 4 Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP89 1.18e-12 68 34 7 172 3 CYP6 Peptidyl-prolyl cis-trans isomerase-like 4 Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q0ZQK6 1.19e-12 65 35 7 138 3 PPIA Peptidyl-prolyl cis-trans isomerase A Symphalangus syndactylus
Q5R8S7 1.19e-12 65 35 7 138 2 PPIA Peptidyl-prolyl cis-trans isomerase A Pongo pygmaeus
P62941 1.19e-12 65 35 7 138 2 PPIA Peptidyl-prolyl cis-trans isomerase A Papio anubis
Q0ZQL1 1.19e-12 65 35 7 138 3 PPIA Peptidyl-prolyl cis-trans isomerase A Pan troglodytes
Q0ZQL2 1.19e-12 65 35 7 138 3 PPIA Peptidyl-prolyl cis-trans isomerase A Pan paniscus
Q0ZQK7 1.19e-12 65 35 7 138 3 PPIA Peptidyl-prolyl cis-trans isomerase A Nomascus leucogenys
P62940 1.19e-12 65 35 7 138 1 PPIA Peptidyl-prolyl cis-trans isomerase A Macaca mulatta
Q0ZQK8 1.19e-12 65 35 7 138 3 PPIA Peptidyl-prolyl cis-trans isomerase A Hylobates lar
P62937 1.19e-12 65 35 7 138 1 PPIA Peptidyl-prolyl cis-trans isomerase A Homo sapiens
Q0ZQL0 1.19e-12 65 35 7 138 3 PPIA Peptidyl-prolyl cis-trans isomerase A Gorilla gorilla gorilla
P62938 1.19e-12 65 35 7 138 1 PPIA Peptidyl-prolyl cis-trans isomerase A Chlorocebus aethiops
Q6GLX7 1.2e-12 68 33 6 162 2 cwc27 Spliceosome-associated protein CWC27 homolog Xenopus laevis
Q17QX9 1.23e-12 68 37 4 125 2 CWC27 Spliceosome-associated protein CWC27 homolog Bos taurus
Q6Q151 1.81e-12 68 34 8 167 1 CYP59 Peptidyl-prolyl cis-trans isomerase CYP59 Arabidopsis thaliana
Q01490 1.83e-12 66 34 8 170 1 CYPB Peptidyl-prolyl cis-trans isomerase B Orpinomyces sp. (strain PC-2)
Q42406 2.33e-12 65 37 8 148 1 CYP18-4 Peptidyl-prolyl cis-trans isomerase CYP18-4 Arabidopsis thaliana
P10111 2.37e-12 65 35 7 138 1 Ppia Peptidyl-prolyl cis-trans isomerase A Rattus norvegicus
Q9SP02 2.58e-12 65 35 9 159 1 CYP20-1 Peptidyl-prolyl cis-trans isomerase CYP20-1 Arabidopsis thaliana
P62936 2.88e-12 65 34 6 138 1 PPIA Peptidyl-prolyl cis-trans isomerase A Sus scrofa
P62935 2.88e-12 65 34 6 138 1 PPIA Peptidyl-prolyl cis-trans isomerase A Bos taurus
Q9V3G3 3.3e-12 67 33 5 153 1 cyp33 Peptidyl-prolyl cis-trans isomerase E Drosophila melanogaster
P23284 3.58e-12 65 36 10 155 1 PPIB Peptidyl-prolyl cis-trans isomerase B Homo sapiens
P54985 3.82e-12 64 35 5 137 2 CYPA Peptidyl-prolyl cis-trans isomerase Blattella germanica
P34887 4.87e-12 63 39 5 109 2 CYP Peptidyl-prolyl cis-trans isomerase Allium cepa
Q4I5R9 5.96e-12 65 34 8 152 3 CPR2 Peptidyl-prolyl cis-trans isomerase B Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P0CP78 6.79e-12 65 35 9 161 3 CPR2 Peptidyl-prolyl cis-trans isomerase B Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q4G338 8.01e-12 65 37 8 141 1 None Peptidyl-prolyl cis-trans isomerase E Haemonchus contortus
Q9TTC6 8.57e-12 63 34 7 138 2 PPIA Peptidyl-prolyl cis-trans isomerase A Oryctolagus cuniculus
P0CP79 8.62e-12 65 35 9 161 3 CPR2 Peptidyl-prolyl cis-trans isomerase B Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
P52013 1.2e-11 63 38 6 136 1 cyn-5 Peptidyl-prolyl cis-trans isomerase 5 Caenorhabditis elegans
Q9UA41 1.29e-11 63 32 5 145 1 cypD Peptidyl-prolyl cis-trans isomerase D, mitochondrial Dictyostelium discoideum
Q0ZQK3 1.3e-11 63 34 6 138 3 PPIA Peptidyl-prolyl cis-trans isomerase A Saguinus oedipus
Q6DTV9 1.3e-11 63 34 6 138 2 PPIA Peptidyl-prolyl cis-trans isomerase A Aotus trivirgatus
P0C1H8 1.43e-11 63 36 6 136 3 cyp1 Peptidyl-prolyl cis-trans isomerase A2 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
P25007 1.52e-11 64 37 6 132 1 Cyp1 Peptidyl-prolyl cis-trans isomerase Drosophila melanogaster
Q4WVU5 1.82e-11 65 27 5 165 3 cyp8 Peptidyl-prolyl cis-trans isomerase-like 2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q7SG06 1.98e-11 63 34 7 159 3 cyp-3 Peptidyl-prolyl cis-trans isomerase H Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P18253 2.12e-11 62 36 6 136 3 ppi1 Peptidyl-prolyl cis-trans isomerase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P24525 2.3e-11 62 34 6 144 2 CYP Peptidyl-prolyl cis-trans isomerase Brassica napus
P34790 2.47e-11 62 34 7 161 1 CYP18-3 Peptidyl-prolyl cis-trans isomerase CYP18-3 Arabidopsis thaliana
Q8HXS3 2.62e-11 62 35 8 140 2 PPIA Peptidyl-prolyl cis-trans isomerase A Felis catus
Q5BAH7 2.72e-11 63 30 6 179 3 cyp10 Peptidyl-prolyl cis-trans isomerase-like 3 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q4L4W9 2.86e-11 63 30 6 186 3 SH1997 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus haemolyticus (strain JCSC1435)
Q4IPB3 3.09e-11 64 31 3 125 3 CWC27 Peptidyl-prolyl isomerase CWC27 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P21568 4.27e-11 62 35 7 147 1 CYP Peptidyl-prolyl cis-trans isomerase Solanum lycopersicum
Q8CT84 4.5e-11 62 29 6 186 3 SE_0648 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQK8 4.5e-11 62 29 6 186 3 SERP0540 Putative peptidyl-prolyl cis-trans isomerase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9SKQ0 5.25e-11 61 34 8 159 2 CYP19-2 Peptidyl-prolyl cis-trans isomerase CYP19-2 Arabidopsis thaliana
P35627 7.12e-11 61 40 6 119 2 None Peptidyl-prolyl cis-trans isomerase Unspecified eudicot DB-1992
P77949 7.2e-11 61 32 8 177 1 cypB Peptidyl-prolyl cis-trans isomerase B Streptomyces anulatus
P91791 7.37e-11 61 35 6 131 2 None Peptidyl-prolyl cis-trans isomerase Hemicentrotus pulcherrimus
Q39613 7.42e-11 61 35 7 143 1 PCKR1 Peptidyl-prolyl cis-trans isomerase Catharanthus roseus
Q2U5W8 8.08e-11 63 31 3 129 3 cyp8 Peptidyl-prolyl cis-trans isomerase-like 2 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q7SBX8 8.44e-11 63 31 3 125 3 cwc-27 Peptidyl-prolyl isomerase cwc-27 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q4WMB6 1.02e-10 61 29 7 181 3 cyp10 Peptidyl-prolyl cis-trans isomerase-like 3 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P0C1I6 1.02e-10 63 31 6 168 3 cyp13 Peptidyl-prolyl cis-trans isomerase-like 4 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q4IPH4 1.08e-10 61 32 5 143 3 CYP3 Peptidyl-prolyl cis-trans isomerase H Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P0DN26 1.18e-10 60 34 7 138 3 PPIAL4F Peptidyl-prolyl cis-trans isomerase A-like 4F Homo sapiens
A0A075B759 1.18e-10 60 34 7 138 3 PPIAL4E Peptidyl-prolyl cis-trans isomerase A-like 4E Homo sapiens
P25719 1.43e-10 60 33 8 153 1 CPR3 Peptidyl-prolyl cis-trans isomerase C, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A0B4J2A2 1.44e-10 60 34 7 138 2 PPIAL4C Peptidyl-prolyl cis-trans isomerase A-like 4C Homo sapiens
O74729 1.62e-10 60 33 8 156 3 cyp3 Peptidyl-prolyl cis-trans isomerase cyp3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q26565 1.69e-10 60 33 6 135 1 None Peptidyl-prolyl cis-trans isomerase Schistosoma mansoni
P14832 1.82e-10 60 34 7 141 1 CPR1 Peptidyl-prolyl cis-trans isomerase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P0C1H7 2.43e-10 59 35 7 142 3 cyp2 Peptidyl-prolyl cis-trans isomerase A1 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
F5H284 2.62e-10 59 34 7 138 3 PPIAL4D Peptidyl-prolyl cis-trans isomerase A-like 4D Homo sapiens
Q41651 2.64e-10 60 31 6 154 1 None Peptidyl-prolyl cis-trans isomerase, chloroplastic Vicia faba
Q4P7H2 3.03e-10 61 31 5 141 3 CWC27 Peptidyl-prolyl isomerase CWC27 Ustilago maydis (strain 521 / FGSC 9021)
P30405 3.13e-10 60 35 8 141 1 PPIF Peptidyl-prolyl cis-trans isomerase F, mitochondrial Homo sapiens
P52015 3.24e-10 59 33 6 138 1 cyn-7 Peptidyl-prolyl cis-trans isomerase 7 Caenorhabditis elegans
Q99KR7 3.42e-10 60 35 8 141 1 Ppif Peptidyl-prolyl cis-trans isomerase F, mitochondrial Mus musculus
Q4IPB8 3.79e-10 59 30 7 167 3 CYP10 Peptidyl-prolyl cis-trans isomerase-like 3 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P30412 3.92e-10 60 36 10 158 1 Ppic Peptidyl-prolyl cis-trans isomerase C Mus musculus
O43447 4.17e-10 59 35 9 157 1 PPIH Peptidyl-prolyl cis-trans isomerase H Homo sapiens
Q0P5D0 4.17e-10 59 35 9 157 2 PPIH Peptidyl-prolyl cis-trans isomerase H Bos taurus
O49886 4.62e-10 59 34 7 143 2 None Peptidyl-prolyl cis-trans isomerase Lupinus luteus
P29117 4.72e-10 59 35 8 141 1 Ppif Peptidyl-prolyl cis-trans isomerase F, mitochondrial Rattus norvegicus
Q08E11 4.99e-10 59 38 7 132 2 PPIC Peptidyl-prolyl cis-trans isomerase C Bos taurus
Q9C566 5.06e-10 60 34 9 169 2 CYP40 Peptidyl-prolyl cis-trans isomerase CYP40 Arabidopsis thaliana
Q2TZ33 6.47e-10 58 33 6 157 3 cyp3 Peptidyl-prolyl cis-trans isomerase H Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P30404 7.55e-10 59 34 8 145 1 PPIF Peptidyl-prolyl cis-trans isomerase F, mitochondrial Bos taurus
Q94A16 8.87e-10 59 27 4 156 2 CYP21-3 Peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial Arabidopsis thaliana
Q7RXA6 9.96e-10 60 27 5 177 3 ppi-2 Peptidyl-prolyl cis-trans isomerase-like 2 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P52010 1.23e-09 58 31 5 148 2 cyn-2 Peptidyl-prolyl cis-trans isomerase 2 Caenorhabditis elegans
P45877 1.47e-09 58 37 7 132 1 PPIC Peptidyl-prolyl cis-trans isomerase C Homo sapiens
P0C1I2 1.49e-09 59 33 8 155 3 cyp10 Peptidyl-prolyl cis-trans isomerase E Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
P0DN37 1.66e-09 57 33 7 138 1 PPIAL4G Peptidyl-prolyl cis-trans isomerase A-like 4G Homo sapiens
P0C1I8 1.66e-09 57 33 4 120 3 cyp6 Peptidyl-prolyl cis-trans isomerase cyp6 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
P52018 1.67e-09 57 37 7 141 2 cyn-11 Peptidyl-prolyl cis-trans isomerase 11 Caenorhabditis elegans
A0A075B767 1.95e-09 57 32 6 137 1 PPIAL4H Peptidyl-prolyl cis-trans isomerase A-like 4H Homo sapiens
Q38900 2.19e-09 57 33 7 145 1 CYP19-1 Peptidyl-prolyl cis-trans isomerase CYP19-1 Arabidopsis thaliana
Q38867 2.21e-09 57 34 4 123 2 CYP19-3 Peptidyl-prolyl cis-trans isomerase CYP19-3 Arabidopsis thaliana
P14088 2.39e-09 57 34 6 135 2 CYP-1 Peptidyl-prolyl cis-trans isomerase Echinococcus granulosus
Q9D868 2.98e-09 57 33 6 136 1 Ppih Peptidyl-prolyl cis-trans isomerase H Mus musculus
Q9QZH3 3.23e-09 58 32 7 146 1 Ppie Peptidyl-prolyl cis-trans isomerase E Mus musculus
Q5AQL0 3.53e-09 57 33 7 152 3 cyp3 Peptidyl-prolyl cis-trans isomerase H Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5R723 3.99e-09 58 32 7 146 2 PPIE Peptidyl-prolyl cis-trans isomerase E Pongo abelii
Q9UNP9 4.27e-09 58 32 7 146 1 PPIE Peptidyl-prolyl cis-trans isomerase E Homo sapiens
P84343 4.54e-09 56 36 5 119 1 None Peptidyl-prolyl cis-trans isomerase Neospora caninum
Q9TW32 5.13e-09 56 32 8 150 1 cypB Peptidyl-prolyl cis-trans isomerase B Dictyostelium discoideum
Q9Y536 5.77e-09 56 33 7 138 1 PPIAL4A Peptidyl-prolyl cis-trans isomerase A-like 4A Homo sapiens
P15425 6.02e-09 57 27 7 188 1 ninaA Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme Drosophila melanogaster
Q4PCH8 6.28e-09 56 32 5 130 3 CYP10 Peptidyl-prolyl cis-trans isomerase-like 3 Ustilago maydis (strain 521 / FGSC 9021)
P52011 6.45e-09 56 28 6 164 1 cyn-3 Peptidyl-prolyl cis-trans isomerase 3 Caenorhabditis elegans
Q8W171 7.95e-09 55 33 7 145 2 Cyp1 Peptidyl-prolyl cis-trans isomerase 1 Glycine max
Q871A4 8.23e-09 57 30 9 185 3 cyp-6 Peptidyl-prolyl cis-trans isomerase-like 4 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q6CGK4 8.39e-09 57 32 2 112 3 CWC27 Peptidyl-prolyl isomerase CWC27 Yarrowia lipolytica (strain CLIB 122 / E 150)
P52016 9.09e-09 57 31 7 169 2 cyn-8 Peptidyl-prolyl cis-trans isomerase 8 Caenorhabditis elegans
P22011 1.04e-08 55 35 7 131 1 CYP1 Peptidyl-prolyl cis-trans isomerase Candida albicans (strain SC5314 / ATCC MYA-2876)
P0CP82 1.06e-08 55 32 6 146 3 CYP3 Peptidyl-prolyl cis-trans isomerase H Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP83 1.06e-08 55 32 6 146 3 CYP3 Peptidyl-prolyl cis-trans isomerase H Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
A4FV72 1.15e-08 56 31 7 146 2 PPIE Peptidyl-prolyl cis-trans isomerase E Bos taurus
Q6C4W6 1.17e-08 56 32 7 170 3 CPR2 Peptidyl-prolyl cis-trans isomerase B Yarrowia lipolytica (strain CLIB 122 / E 150)
P0C1I7 1.17e-08 55 31 6 132 3 cyp5 Peptidyl-prolyl cis-trans isomerase cyp5 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
P9WHW1 1.2e-08 56 28 6 153 1 ppiB Probable peptidyl-prolyl cis-trans isomerase B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHW0 1.2e-08 56 28 6 153 3 ppiB Probable peptidyl-prolyl cis-trans isomerase B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9ASS6 1.37e-08 56 34 6 136 1 PNSL5 Photosynthetic NDH subunit of lumenal location 5, chloroplastic Arabidopsis thaliana
P34791 1.38e-08 56 32 8 155 1 CYP20-3 Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic Arabidopsis thaliana
Q54SM3 1.83e-08 55 39 7 111 1 ppiA Peptidyl-prolyl cis-trans isomerase A Dictyostelium discoideum
O49605 2.05e-08 55 33 9 171 2 CYP21-1 Peptidyl-prolyl cis-trans isomerase CYP21-1 Arabidopsis thaliana
O00060 2.59e-08 54 36 6 130 2 PIG28 Peptidyl-prolyl cis-trans isomerase Uromyces fabae
Q4WCM6 2.7e-08 54 33 7 153 3 cyp3 Peptidyl-prolyl cis-trans isomerase H Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q27450 2.89e-08 56 29 5 167 1 CYP-1 Peptidyl-prolyl cis-trans isomerase 1 Brugia malayi
Q6MWS8 3.05e-08 54 30 5 134 3 cyp-10 Peptidyl-prolyl cis-trans isomerase-like 3 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q26516 6.06e-08 53 35 8 140 2 None Peptidyl-prolyl cis-trans isomerase E (Fragment) Schistosoma japonicum
P30415 6.13e-08 55 29 7 171 1 Nktr NK-tumor recognition protein Mus musculus
Q26548 6.15e-08 54 35 8 138 1 None Peptidyl-prolyl cis-trans isomerase E Schistosoma mansoni
Q4P6X6 7.21e-08 52 32 6 144 3 CYP3 Peptidyl-prolyl cis-trans isomerase H (Fragment) Ustilago maydis (strain 521 / FGSC 9021)
Q9CDE9 7.87e-08 53 30 8 188 3 ppiA Probable peptidyl-prolyl cis-trans isomerase A Mycobacterium leprae (strain TN)
P28517 1.11e-07 53 30 6 156 2 NINAA Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme Calliphora vicina
P0CP81 1.33e-07 53 32 4 125 3 CPR6 Peptidyl-prolyl cis-trans isomerase D Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
P30414 1.39e-07 54 28 6 170 1 NKTR NK-tumor recognition protein Homo sapiens
Q4P0V4 1.41e-07 53 36 5 106 3 CPR6 Peptidyl-prolyl cis-trans isomerase D Ustilago maydis (strain 521 / FGSC 9021)
Q11004 1.71e-07 53 34 6 138 2 wis2 40 kDa peptidyl-prolyl cis-trans isomerase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q6CBP4 1.73e-07 53 30 6 162 3 CPR6 Peptidyl-prolyl cis-trans isomerase D Yarrowia lipolytica (strain CLIB 122 / E 150)
Q9P3X9 1.87e-07 53 30 6 164 1 cyp41 41 kDa peptidyl-prolyl cis-trans isomerase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q5ARI5 1.88e-07 53 28 6 174 3 cyp6 Peptidyl-prolyl cis-trans isomerase-like 4 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P0CP80 2.16e-07 53 32 4 125 3 CPR6 Peptidyl-prolyl cis-trans isomerase D Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q1RMP7 2.23e-07 53 26 6 186 2 PPIL6 Probable inactive peptidyl-prolyl cis-trans isomerase-like 6 Bos taurus
Q4WAQ9 2.87e-07 53 28 6 174 3 cyp6 Peptidyl-prolyl cis-trans isomerase-like 4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P9WHW3 3.39e-07 51 29 8 188 1 ppiA Peptidyl-prolyl cis-trans isomerase A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHW2 3.39e-07 51 29 8 188 3 ppiA Peptidyl-prolyl cis-trans isomerase A Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65763 3.39e-07 51 29 8 188 3 ppiA Probable peptidyl-prolyl cis-trans isomerase A Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P26882 3.57e-07 52 29 8 172 1 PPID Peptidyl-prolyl cis-trans isomerase D Bos taurus
Q5U8Z7 4.88e-07 52 36 7 125 2 Cyp40 Peptidyl-prolyl cis-trans isomerase D Amanita muscaria
H2QII6 5.3e-07 52 35 7 133 1 RANBP2 E3 SUMO-protein ligase RanBP2 Pan troglodytes
P0C1I9 5.72e-07 52 30 8 165 3 cyp11 Peptidyl-prolyl cis-trans isomerase cyp11 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q5B4E7 8.3e-07 51 31 6 163 3 cpr6 Peptidyl-prolyl cis-trans isomerase D Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q4IE79 1.31e-06 51 30 9 185 3 CYP6 Peptidyl-prolyl cis-trans isomerase-like 4 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q9CXG3 1.54e-06 50 28 6 171 1 Ppil4 Peptidyl-prolyl cis-trans isomerase-like 4 Mus musculus
Q2U0E0 1.81e-06 50 34 5 127 3 cpr6 Peptidyl-prolyl cis-trans isomerase D Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q8WUA2 2.42e-06 50 27 6 171 1 PPIL4 Peptidyl-prolyl cis-trans isomerase-like 4 Homo sapiens
P10255 2.54e-06 49 31 9 138 1 csr-1 Peptidyl-prolyl cis-trans isomerase, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q9ERU9 3.57e-06 50 32 6 132 1 Ranbp2 E3 SUMO-protein ligase RanBP2 Mus musculus
Q08752 4.6e-06 49 29 6 134 1 PPID Peptidyl-prolyl cis-trans isomerase D Homo sapiens
P48820 5.73e-06 49 35 7 131 2 RANBP2 E3 SUMO-protein ligase RanBP2 (Fragment) Bos taurus
Q9UUE4 6.18e-06 48 28 7 172 1 cyp6 Peptidyl-prolyl cis-trans isomerase cyp6 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q2U256 6.31e-06 48 27 7 176 3 cyp6 Peptidyl-prolyl cis-trans isomerase-like 4 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P49792 7.64e-06 49 34 7 133 1 RANBP2 E3 SUMO-protein ligase RanBP2 Homo sapiens
P0C1I1 7.89e-06 48 32 6 152 3 cyp12 Peptidyl-prolyl cis-trans isomerase D Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q75A33 8.48e-06 48 34 5 125 3 CPR6 Peptidyl-prolyl cis-trans isomerase D Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q6DGG0 9.32e-06 48 28 8 172 1 Ppid Peptidyl-prolyl cis-trans isomerase D Rattus norvegicus
P73789 1.01e-05 47 30 8 140 1 slr1251 Peptidyl-prolyl cis-trans isomerase slr1251 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9LY75 1.06e-05 48 34 6 126 1 CYP63 Peptidyl-prolyl cis-trans isomerase CYP63 Arabidopsis thaliana
Q9CR16 1.15e-05 48 29 6 134 1 Ppid Peptidyl-prolyl cis-trans isomerase D Mus musculus
O00845 1.47e-05 46 29 7 161 3 None Peptidyl-prolyl cis-trans isomerase Paramecium primaurelia
Q6BWH6 1.47e-05 47 29 6 137 3 CWC27 Peptidyl-prolyl isomerase CWC27 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q4WIF3 1.85e-05 47 29 5 165 3 cpr6 Peptidyl-prolyl cis-trans isomerase D Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P0C1I3 2.12e-05 46 32 8 156 3 cyp7 Peptidyl-prolyl cis-trans isomerase H Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q4HXF6 2.16e-05 47 32 7 154 3 CPR6 Peptidyl-prolyl cis-trans isomerase D Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q09637 2.49e-05 47 29 7 163 2 cyn-9 Peptidyl-prolyl cis-trans isomerase 9 Caenorhabditis elegans
Q06118 3.28e-05 45 32 8 140 1 ppiA Peptidyl-prolyl cis-trans isomerase A Streptomyces anulatus
A8X8D0 7.39e-05 45 29 8 167 2 cyn-9 Peptidyl-prolyl cis-trans isomerase 9 Caenorhabditis briggsae
Q13427 0.000115 45 32 4 109 1 PPIG Peptidyl-prolyl cis-trans isomerase G Homo sapiens
G5EEW6 0.000117 45 23 5 165 1 sig-7 Peptidyl-prolyl cis-trans isomerase sig-7 Caenorhabditis elegans
A2AR02 0.000117 45 32 4 109 1 Ppig Peptidyl-prolyl cis-trans isomerase G Mus musculus
O55035 0.000131 45 32 4 109 1 Ppig Peptidyl-prolyl cis-trans isomerase G Rattus norvegicus
Q6FNU6 0.000439 43 28 6 166 3 CPR6 Peptidyl-prolyl cis-trans isomerase D Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q5ACI8 0.000455 43 32 4 108 3 CPR6 Peptidyl-prolyl cis-trans isomerase D Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8IXY8 0.000698 42 27 4 112 1 PPIL6 Probable inactive peptidyl-prolyl cis-trans isomerase-like 6 Homo sapiens

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13945
Feature type CDS
Gene ppiA
Product peptidylprolyl isomerase A
Location 3096808 - 3097380 (strand: -1)
Length 573 (nucleotides) / 190 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1701
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00160 Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0652 Posttranslational modification, protein turnover, chaperones (O) O Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03767 peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8] Cationic antimicrobial peptide (CAMP) resistance
Viral life cycle - HIV-1
Necroptosis		 -

Protein Sequence

MLKRFFVTLVTACTLTTTSLAMAATGETFVKLVTSEGNIELSLDNKKAPITTKNFIQYVEDGYYNGTTFHRVIPGFMIQGGGFTADLQQKQTREPIKNEADNGLRNLKGTIAMARTSDKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVVDKISQVQTRNIGPYQNVPVKTVTILSAEVVKE

Flanking regions ( +/- flanking 50bp)

ATCGCTGCATATTAAGTAAGTTGTAGACTATTAAAGTAAAGGATCCCTGCATGTTAAAACGTTTTTTTGTCACTCTCGTTACCGCTTGCACCTTGACAACCACAAGCCTTGCAATGGCTGCAACGGGAGAGACCTTTGTTAAATTAGTCACATCTGAAGGCAATATTGAACTGTCACTGGATAATAAAAAAGCCCCTATCACAACGAAAAATTTTATTCAGTATGTCGAAGATGGTTACTATAACGGGACCACTTTTCATCGAGTGATCCCCGGATTTATGATCCAAGGTGGGGGATTTACGGCAGATTTGCAACAAAAGCAGACACGAGAGCCGATTAAGAATGAGGCTGATAATGGCTTACGTAACTTAAAAGGCACCATTGCAATGGCTCGTACATCAGATAAAGACAGTGCCACAAGCCAATTCTTTATTAATGTTGCTGATAATGCCTTTTTAGATCACGGTCAACGTGATTTTGGTTATGCGGTGTTTGGTAAAGTAGTGAAAGGCATGGATGTTGTCGATAAAATTTCACAAGTGCAAACCCGCAATATTGGTCCTTACCAAAATGTACCCGTTAAAACCGTGACGATTTTATCCGCTGAGGTGGTTAAAGAATAATGGGTGATTAGGTTAGACACTTCTCTAGCCTAAGCCAGTCAATGAACAGA