Homologs in group_1684

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11750 FBDBKF_11750 99.2 Morganella morganii S1 - Small ribosomal subunit protein uS12
EHELCC_14555 EHELCC_14555 99.2 Morganella morganii S2 - Small ribosomal subunit protein uS12
NLDBIP_15655 NLDBIP_15655 99.2 Morganella morganii S4 - Small ribosomal subunit protein uS12
LHKJJB_14960 LHKJJB_14960 99.2 Morganella morganii S3 - Small ribosomal subunit protein uS12
HKOGLL_19330 HKOGLL_19330 99.2 Morganella morganii S5 - Small ribosomal subunit protein uS12
F4V73_RS14910 F4V73_RS14910 98.4 Morganella psychrotolerans rpsL 30S ribosomal protein S12

Distribution of the homologs in the orthogroup group_1684

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1684

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EYV9 7.26e-87 251 100 0 124 3 rpsL Small ribosomal subunit protein uS12 Proteus mirabilis (strain HI4320)
Q7N9B4 4.93e-84 244 96 0 124 3 rpsL Small ribosomal subunit protein uS12 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NQL4 9.73e-84 243 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Sodalis glossinidius (strain morsitans)
B1JIV3 1.67e-83 242 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664R4 1.67e-83 242 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CCT6 1.67e-83 242 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R464 1.67e-83 242 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJB5 1.67e-83 242 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis
B2K5N7 1.67e-83 242 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2T8 1.67e-83 242 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNP1 1.67e-83 242 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS57 1.67e-83 242 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKK4 6.02e-83 241 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Serratia proteamaculans (strain 568)
A6TEY0 8.65e-83 241 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XN85 8.65e-83 241 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Klebsiella pneumoniae (strain 342)
C6DG82 9.97e-83 240 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZW3 9.97e-83 240 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P63195 1.34e-82 240 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Mannheimia haemolytica
P63196 1.34e-82 240 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHB9 1.34e-82 240 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus influenzae (strain PittGG)
A5U9Q8 1.34e-82 240 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus influenzae (strain PittEE)
Q4QMT8 1.34e-82 240 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus influenzae (strain 86-028NP)
B0BQZ5 1.34e-82 240 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2G5 1.34e-82 240 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N249 1.34e-82 240 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q3YWT0 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella sonnei (strain Ss046)
P0A7S8 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella flexneri
Q0SZX5 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella flexneri serotype 5b (strain 8401)
Q32B24 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VU7 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella boydii serotype 4 (strain Sb227)
B2U2U9 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7S6 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7S7 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella typhi
B4TXF0 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella schwarzengrund (strain CVM19633)
B5BGZ4 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella paratyphi A (strain AKU_12601)
C0Q0C4 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella paratyphi C (strain RKS4594)
Q5PIW1 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUU8 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella newport (strain SL254)
B4TKM3 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella heidelberg (strain SL476)
B5RH07 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R299 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella enteritidis PT4 (strain P125109)
B5FJM2 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella dublin (strain CT_02021853)
Q57J24 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella choleraesuis (strain SC-B67)
B5F8G0 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella agona (strain SL483)
B7LS48 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WFD5 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Enterobacter sp. (strain 638)
Q1R5U1 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain UTI89 / UPEC)
B1LHE2 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain SMS-3-5 / SECEC)
B6I242 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain SE11)
B7NDV0 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7S3 1.97e-82 239 93 0 124 1 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain K12)
B1IPV7 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7S4 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AGM9 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O1:K1 / APEC
A8A5E9 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O9:H4 (strain HS)
B7M1P3 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O8 (strain IAI1)
B7N1C3 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O81 (strain ED1a)
B7NLP7 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTP9 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7S5 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O157:H7
B7L4L7 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain 55989 / EAEC)
B7MCV7 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK52 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSL7 1.97e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O139:H28 (strain E24377A / ETEC)
B2VK38 2.48e-82 239 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4TGY4 2.71e-82 239 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis (strain Pestoides F)
C5BGN0 2.89e-82 239 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Edwardsiella ictaluri (strain 93-146)
Q65W91 4.29e-82 239 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B8F7Z2 4.69e-82 239 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Glaesserella parasuis serovar 5 (strain SH0165)
Q0TCB7 5.23e-82 239 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
C4ZUJ7 5.23e-82 239 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain K12 / MC4100 / BW2952)
Q9Z6D2 5.29e-82 238 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87L43 9.36e-82 238 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MZ64 9.36e-82 238 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio campbellii (strain ATCC BAA-1116)
Q9CL86 2.04e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Pasteurella multocida (strain Pm70)
Q5F1R7 2.04e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Glaesserella parasuis
B0UWC6 2.66e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Histophilus somni (strain 2336)
Q0I535 2.66e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Histophilus somni (strain 129Pt)
A4SHV6 3.38e-81 236 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Aeromonas salmonicida (strain A449)
A0KQ98 3.38e-81 236 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7MH40 5.48e-81 236 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio vulnificus (strain YJ016)
Q8DCR0 5.48e-81 236 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio vulnificus (strain CMCP6)
B5FG04 5.79e-81 236 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Aliivibrio fischeri (strain MJ11)
Q5E8C1 5.79e-81 236 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Aliivibrio fischeri (strain ATCC 700601 / ES114)
C4LBU6 9.91e-81 235 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B6EPR5 1.38e-80 235 90 0 124 3 rpsL Small ribosomal subunit protein uS12 Aliivibrio salmonicida (strain LFI1238)
P45809 1.59e-80 235 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Erwinia amylovora
C3LR91 3.62e-80 234 90 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUZ9 3.62e-80 234 90 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5QWB6 9.72e-80 233 89 0 124 3 rpsL Small ribosomal subunit protein uS12 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A5F3L3 9.83e-80 233 89 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VLG2 1.31e-79 233 90 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio atlanticus (strain LGP32)
A3Q977 2.32e-78 229 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q6LVC3 2.34e-78 229 89 0 124 3 rpsL Small ribosomal subunit protein uS12 Photobacterium profundum (strain SS9)
Q47UW1 3.19e-78 229 88 0 124 3 rpsL Small ribosomal subunit protein uS12 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q1LSY7 4.24e-78 229 90 0 124 3 rpsL Small ribosomal subunit protein uS12 Baumannia cicadellinicola subsp. Homalodisca coagulata
A8G1F3 2.06e-77 227 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sediminis (strain HAW-EB3)
Q21M91 3.89e-77 226 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A8GYX1 4.25e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TM17 4.25e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella halifaxensis (strain HAW-EB4)
B1KMY8 4.49e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella woodyi (strain ATCC 51908 / MS32)
B8CNC7 4.49e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q089Q9 6.66e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella frigidimarina (strain NCIMB 400)
Q12SW4 8.2e-77 225 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1REA9 9.16e-77 225 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sp. (strain W3-18-1)
A4YBY8 9.16e-77 225 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A0KRL9 1.06e-76 225 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sp. (strain ANA-3)
A6W397 1.08e-76 225 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Marinomonas sp. (strain MWYL1)
B8D854 1.42e-76 225 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57595 1.42e-76 225 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9V2 1.42e-76 225 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q31IY7 1.83e-76 224 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9HWD0 3e-76 224 88 0 123 1 rpsL Small ribosomal subunit protein uS12 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T85 3e-76 224 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V639 3e-76 224 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas aeruginosa (strain LESB58)
A6UZI3 3e-76 224 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas aeruginosa (strain PA7)
A1TYJ2 3.31e-76 224 86 0 124 3 rpsL Small ribosomal subunit protein uS12 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q89A65 3.65e-76 224 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q3ILP7 3.9e-76 224 87 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudoalteromonas translucida (strain TAC 125)
Q1Q8N9 4.07e-76 224 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FQG3 4.07e-76 224 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1S213 5.91e-76 223 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0I0B0 6.46e-76 223 86 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sp. (strain MR-7)
Q0HNU2 6.46e-76 223 86 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sp. (strain MR-4)
P59166 6.46e-76 223 86 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8D3H4 7.7e-76 223 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Wigglesworthia glossinidia brevipalpis
A5WGL2 8.22e-76 223 86 0 124 3 rpsL Small ribosomal subunit protein uS12 Psychrobacter sp. (strain PRwf-1)
A9KW97 9.38e-76 223 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella baltica (strain OS195)
A6WHS3 9.38e-76 223 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella baltica (strain OS185)
B8EBL0 9.38e-76 223 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella baltica (strain OS223)
Q1R0I0 1.25e-75 223 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8K947 1.36e-75 222 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q056Z9 2.07e-75 222 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A4XZ95 4.97e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas mendocina (strain ymp)
Q5WZL7 5.37e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Legionella pneumophila (strain Lens)
Q5ZYP8 5.37e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHR9 5.37e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Legionella pneumophila (strain Corby)
Q5X864 5.37e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Legionella pneumophila (strain Paris)
C5BQ41 6.91e-75 221 87 0 123 3 rpsL Small ribosomal subunit protein uS12 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B0V8W3 7.54e-75 221 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain AYE)
A3M304 7.54e-75 221 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VTG5 7.54e-75 221 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain SDF)
B2HUQ2 7.54e-75 221 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain ACICU)
B7I7R9 7.54e-75 221 84 0 123 1 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain AB0057)
B7GYN0 7.54e-75 221 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain AB307-0294)
Q6FDS8 7.71e-75 221 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C1DKK7 9.71e-75 220 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q15YA9 1.22e-74 220 84 0 124 3 rpsL Small ribosomal subunit protein uS12 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q2S907 1.38e-74 220 84 0 124 3 rpsL Small ribosomal subunit protein uS12 Hahella chejuensis (strain KCTC 2396)
Q7NQE8 2e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4VHM5 2.78e-74 219 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Stutzerimonas stutzeri (strain A1501)
A1T059 2.97e-74 219 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B1JDW9 3.66e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas putida (strain W619)
Q88QP0 3.66e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXP2 3.66e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFX1 3.66e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas entomophila (strain L48)
Q4ZMN9 4.04e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas syringae pv. syringae (strain B728a)
Q889X6 4.04e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C3K2Y1 4.04e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas fluorescens (strain SBW25)
Q48D31 4.04e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q47JA8 4.09e-74 219 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Dechloromonas aromatica (strain RCB)
Q82T68 7.55e-74 218 84 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B8GV63 7.64e-74 218 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q2YB02 8.34e-74 218 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
C1DAR2 9.11e-74 218 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Laribacter hongkongensis (strain HLHK9)
Q3K5Y3 1.02e-73 218 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas fluorescens (strain Pf0-1)
Q4K528 1.02e-73 218 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A1KB32 1.03e-73 218 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Azoarcus sp. (strain BH72)
B0KK62 1.11e-73 218 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas putida (strain GB-1)
Q0AIK0 1.98e-73 217 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1KRG8 4.09e-73 216 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66375 4.09e-73 216 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66374 4.09e-73 216 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3X2 4.09e-73 216 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria meningitidis serogroup C (strain 053442)
Q0ABI0 4.88e-73 216 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B3R7T3 5.57e-73 216 84 0 124 3 rpsL Small ribosomal subunit protein uS12 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K609 5.57e-73 216 84 0 124 3 rpsL Small ribosomal subunit protein uS12 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0VSM0 7.32e-73 215 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5P337 7.73e-73 215 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q46WD8 8.35e-73 215 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7VRN7 1.04e-72 215 84 0 124 3 rpsL Small ribosomal subunit protein uS12 Blochmanniella floridana
Q5F5S1 1.1e-72 215 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1H4P2 1.69e-72 214 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q1LI27 2.22e-72 214 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1WVC7 2.7e-72 214 82 0 123 3 rpsL Small ribosomal subunit protein uS12 Halorhodospira halophila (strain DSM 244 / SL1)
Q3J8Q9 2.73e-72 214 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q605A7 3.02e-72 214 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q3SLQ4 3.29e-72 214 82 0 123 3 rpsL Small ribosomal subunit protein uS12 Thiobacillus denitrificans (strain ATCC 25259)
A1W2Q2 4.99e-72 213 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Acidovorax sp. (strain JS42)
B9MB68 4.99e-72 213 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Acidovorax ebreus (strain TPSY)
A9BPR3 6.02e-72 213 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Delftia acidovorans (strain DSM 14801 / SPH-1)
B0U0Z3 8.84e-72 213 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A5CXN5 9.03e-72 213 83 0 123 3 rpsL Small ribosomal subunit protein uS12 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q492A9 1.05e-71 213 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Blochmanniella pennsylvanica (strain BPEN)
A0Q4H9 1.08e-71 213 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. novicida (strain U112)
B2UEM4 1.46e-71 212 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Ralstonia pickettii (strain 12J)
Q8XV08 1.46e-71 212 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A5EX68 1.55e-71 212 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Dichelobacter nodosus (strain VCS1703A)
Q2SU22 5.11e-71 211 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q06 5.11e-71 211 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia pseudomallei (strain K96243)
A3NEI4 5.11e-71 211 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia pseudomallei (strain 668)
Q3JMQ7 5.11e-71 211 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia pseudomallei (strain 1710b)
A3P0B8 5.11e-71 211 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia pseudomallei (strain 1106a)
Q13TG5 8.01e-71 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Paraburkholderia xenovorans (strain LB400)
B2JIH1 8.28e-71 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JAN5 1.02e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BRU3 1.02e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia orbicola (strain AU 1054)
B1JU17 1.02e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia orbicola (strain MC0-3)
A9ADI8 1.02e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39KH2 1.02e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ51 1.02e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5B5 1.02e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3M0 1.02e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia cenocepacia (strain HI2424)
B1YRC5 1.02e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia ambifaria (strain MC40-6)
B2T756 1.36e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1V8A8 1.43e-70 210 80 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia mallei (strain SAVP1)
Q62GK0 1.43e-70 210 80 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia mallei (strain ATCC 23344)
A2S7H1 1.43e-70 210 80 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia mallei (strain NCTC 10229)
A3MRU9 1.43e-70 210 80 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia mallei (strain NCTC 10247)
A4IZT8 1.6e-70 209 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHX2 1.6e-70 209 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNT1 1.6e-70 209 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. holarctica (strain OSU18)
B2SDY9 1.6e-70 209 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5H4 1.6e-70 209 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. holarctica (strain LVS)
A7N9S2 1.6e-70 209 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JC4 1.6e-70 209 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. tularensis (strain FSC 198)
Q3A9R0 2.27e-70 209 80 0 124 3 rpsL Small ribosomal subunit protein uS12 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B5ELX4 2.74e-70 209 82 0 123 3 rpsL Small ribosomal subunit protein uS12 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J462 2.74e-70 209 82 0 123 3 rpsL Small ribosomal subunit protein uS12 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A1AVJ5 4.25e-70 208 82 0 123 3 rpsL Small ribosomal subunit protein uS12 Ruthia magnifica subsp. Calyptogena magnifica
A9IJ10 1.33e-69 207 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2W2I6 1.36e-69 207 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A6T3K9 1.64e-69 207 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Janthinobacterium sp. (strain Marseille)
A4G9U3 1.64e-69 207 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Herminiimonas arsenicoxydans
Q21RV3 1.64e-69 207 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q7VTD7 1.89e-69 207 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2G0 1.89e-69 207 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRC9 1.89e-69 207 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2L2H8 1.89e-69 207 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella avium (strain 197N)
A4SUV6 2.38e-69 207 81 0 123 3 rpsL Small ribosomal subunit protein uS12 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q2RQV5 2.49e-69 206 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A1TJ02 3.2e-69 206 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Paracidovorax citrulli (strain AAC00-1)
B1Y7G7 3.34e-69 206 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A0L5W8 3.61e-69 206 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1VIP5 4.25e-69 206 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Polaromonas naphthalenivorans (strain CJ2)
B2TIH0 1.12e-68 205 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYA5 1.12e-68 205 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Alaska E43 / Type E3)
C6C181 1.17e-68 205 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A2SLG2 1.79e-68 204 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q83ES9 1.89e-68 204 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KD36 1.89e-68 204 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Coxiella burnetii (strain Dugway 5J108-111)
Q12GX6 2.06e-68 204 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1WHC0 2.3e-68 204 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Verminephrobacter eiseniae (strain EF01-2)
Q39Y11 2.54e-68 204 82 0 123 3 rpsL Small ribosomal subunit protein uS12 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A6LPQ6 3.17e-68 204 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q8PC54 4.35e-68 203 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URD4 4.35e-68 203 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas campestris pv. campestris (strain 8004)
A7HWQ6 4.7e-68 203 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B2FQ40 5.73e-68 203 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Stenotrophomonas maltophilia (strain K279a)
B4SKV8 5.73e-68 203 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Stenotrophomonas maltophilia (strain R551-3)
B1XSP6 6.82e-68 203 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B8DN92 8.6e-68 202 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
P66380 1.05e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5X5 1.05e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xylella fastidiosa (strain M12)
P66379 1.05e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xylella fastidiosa (strain 9a5c)
A9NAL9 1.32e-67 202 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Coxiella burnetii (strain RSA 331 / Henzerling II)
C5CP60 1.66e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Variovorax paradoxus (strain S110)
Q5GWS8 2.23e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQQ3 2.23e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZY0 2.23e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWY9 2.23e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNS8 2.23e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas axonopodis pv. citri (strain 306)
Q3B6G6 2.87e-67 201 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q3A6Q2 4.22e-67 201 81 0 123 3 rpsL Small ribosomal subunit protein uS12 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B4S5N2 4.4e-67 201 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q0ANP5 4.61e-67 201 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Maricaulis maris (strain MCS10)
B3QR56 5.54e-67 201 77 0 124 3 rpsL Small ribosomal subunit protein uS12 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B6IRQ1 6.47e-67 200 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodospirillum centenum (strain ATCC 51521 / SW)
C4XLW8 7.14e-67 200 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q2JMY0 7.35e-67 201 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q2JUX7 7.43e-67 201 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain JA-3-3Ab)
Q3APG8 7.5e-67 201 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Chlorobium chlorochromatii (strain CaD3)
A1BJ39 8.38e-67 201 77 0 124 3 rpsL Small ribosomal subunit protein uS12 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q30Z36 9.5e-67 200 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A4J106 2.23e-66 199 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B4SBU2 2.77e-66 199 77 0 124 3 rpsL Small ribosomal subunit protein uS12 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q1GP94 3.14e-66 199 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
P63194 3.21e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella suis biovar 1 (strain 1330)
B0CH37 3.21e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VR11 3.21e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8GH23 3.21e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJK6 3.21e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5Q5 3.21e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CQ3 3.21e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella abortus biovar 1 (strain 9-941)
Q2YLZ8 3.21e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella abortus (strain 2308)
B2S684 3.21e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella abortus (strain S19)
B1WQY7 4.04e-66 198 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q6AP76 5.2e-66 198 77 0 122 3 rpsL Small ribosomal subunit protein uS12 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
P17294 5.55e-66 198 75 0 124 3 rps12 Small ribosomal subunit protein uS12c Cyanophora paradoxa
O50563 6.13e-66 198 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Thiomonas delicata
B9M6V0 9.51e-66 197 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q0AUH5 9.6e-66 197 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A0RQI2 9.81e-66 197 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Campylobacter fetus subsp. fetus (strain 82-40)
A6X0B3 1.07e-65 197 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B3E7T0 1.08e-65 197 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B3QY19 1.17e-65 197 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q32S12 1.18e-65 197 77 0 123 3 rps12 Small ribosomal subunit protein uS12c Staurastrum punctulatum
A5D5I5 1.31e-65 197 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B7K837 1.38e-65 197 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Gloeothece citriformis (strain PCC 7424)
A5GAY3 1.43e-65 197 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Geotalea uraniireducens (strain Rf4)
A8EW88 1.49e-65 197 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Aliarcobacter butzleri (strain RM4018)
A6U854 1.52e-65 197 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Sinorhizobium medicae (strain WSM419)
B9JDS4 1.52e-65 197 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q8UE13 1.52e-65 197 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Agrobacterium fabrum (strain C58 / ATCC 33970)
A4SCQ4 1.57e-65 197 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q118Z5 1.72e-65 197 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Trichodesmium erythraeum (strain IMS101)
Q3AW56 1.76e-65 197 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain CC9902)
A6Q6I4 1.8e-65 197 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Sulfurovum sp. (strain NBC37-1)
B8FET9 1.98e-65 197 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulfatibacillum aliphaticivorans
B7JUP8 2.05e-65 197 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Rippkaea orientalis (strain PCC 8801 / RF-1)
A0LII6 2.14e-65 196 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q2G8Y5 2.26e-65 196 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q1ISC7 2.39e-65 196 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Koribacter versatilis (strain Ellin345)
A5V607 2.73e-65 196 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B1ZLJ9 2.76e-65 196 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W4P6 2.76e-65 196 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylorubrum extorquens (strain PA1)
B7L0Q6 2.76e-65 196 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A8LM43 2.94e-65 196 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
P74230 3.35e-65 196 76 0 124 3 rpsL Small ribosomal subunit protein uS12 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A8Z6I5 3.42e-65 196 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter concisus (strain 13826)
B5ZYT0 3.55e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B3PW62 3.55e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium etli (strain CIAT 652)
B9KFG9 3.58e-65 196 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
C3MAX5 3.67e-65 196 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q92QH4 3.67e-65 196 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium meliloti (strain 1021)
B8J3F7 3.87e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B2J5A8 3.91e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A1ALT6 4e-65 196 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A5GIP3 4.13e-65 196 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain WH7803)
B8HVS0 4.74e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q3MDM2 4.76e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YP60 4.76e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B3EP66 4.86e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Chlorobium phaeobacteroides (strain BS1)
A8FKR5 4.86e-65 196 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A1VEC1 5.09e-65 196 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CI5 5.09e-65 196 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q5HVX8 5.13e-65 196 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni (strain RM1221)
A1VYJ6 5.13e-65 196 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PI18 5.13e-65 196 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H4P7 5.13e-65 196 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B8IS80 6e-65 196 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q2N9A5 6e-65 196 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Erythrobacter litoralis (strain HTCC2594)
Q32RQ9 6.07e-65 196 75 0 123 3 rps12 Small ribosomal subunit protein uS12c Zygnema circumcarinatum
A9IW34 6.41e-65 195 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q8KNX8 7.56e-65 195 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q1GK44 7.73e-65 195 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Ruegeria sp. (strain TM1040)
Q97EH2 8.52e-65 195 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q1MIE6 8.62e-65 195 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K9M1 8.62e-65 195 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B1XI66 9.1e-65 195 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A1USK9 9.11e-65 195 76 0 123 3 rpsL1 Small ribosomal subunit protein uS12 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
P13576 1.02e-64 195 73 0 124 3 rpsL Small ribosomal subunit protein uS12 Arthrospira platensis
Q0ID56 1.06e-64 195 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain CC9311)
P56354 1.11e-64 195 75 0 123 3 rps12 Small ribosomal subunit protein uS12c Chlorella vulgaris
Q2S3R9 1.15e-64 195 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Salinibacter ruber (strain DSM 13855 / M31)
Q01W87 1.22e-64 195 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Solibacter usitatus (strain Ellin6076)
Q3AMT3 1.28e-64 194 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain CC9605)
A7HBL4 1.4e-64 194 77 0 122 3 rpsL Small ribosomal subunit protein uS12 Anaeromyxobacter sp. (strain Fw109-5)
P59168 1.4e-64 195 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q7U4D4 1.44e-64 194 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Parasynechococcus marenigrum (strain WH8102)
B1LWS1 1.48e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A4WVL3 1.48e-64 194 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J5S7 1.48e-64 194 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGJ2 1.48e-64 194 76 0 123 3 rpsL1 Small ribosomal subunit protein uS12 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A7I3T8 1.54e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q98N61 1.58e-64 194 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B0TC51 1.62e-64 195 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A0PXU1 1.96e-64 194 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium novyi (strain NT)
B0CCD3 1.98e-64 194 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Acaryochloris marina (strain MBIC 11017)
A2T357 1.98e-64 194 74 0 123 3 rps12-A Small ribosomal subunit protein uS12cz/uS12cy Angiopteris evecta
A6Q1M5 2.05e-64 194 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitratiruptor sp. (strain SB155-2)
A0T0Z8 2.26e-64 194 77 0 124 3 rps12 Small ribosomal subunit protein uS12c Thalassiosira pseudonana
B0UHX4 2.34e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylobacterium sp. (strain 4-46)
A1QZH5 2.42e-64 194 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia turicatae (strain 91E135)
B5RRJ5 2.42e-64 194 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia recurrentis (strain A1)
B5RLU7 2.42e-64 194 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia duttonii (strain Ly)
A5N4P2 2.44e-64 194 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q5LMR2 2.44e-64 194 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B3EH96 2.62e-64 194 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q2RFP2 2.7e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P63199 2.91e-64 194 73 0 124 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P63200 2.91e-64 194 73 0 124 3 rpsL Small ribosomal subunit protein uS12 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B1I1I3 2.98e-64 194 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulforudis audaxviator (strain MP104C)
Q6FZB7 2.98e-64 194 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Bartonella quintana (strain Toulouse)
A1B021 3.25e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Paracoccus denitrificans (strain Pd 1222)
Q4G344 3.28e-64 194 75 0 124 3 rps12 Small ribosomal subunit protein uS12c Emiliania huxleyi
Q160Y1 3.43e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B8H416 3.67e-64 193 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A3K2 3.67e-64 193 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8KAG8 3.73e-64 194 77 0 120 3 rpsL Small ribosomal subunit protein uS12 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q1MPT1 3.75e-64 193 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Lawsonia intracellularis (strain PHE/MN1-00)
A7IFX6 3.96e-64 193 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q661N1 4.09e-64 193 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
B7J1V9 4.09e-64 193 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borreliella burgdorferi (strain ZS7)
O51348 4.09e-64 193 75 0 124 1 rpsL Small ribosomal subunit protein uS12 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q0SNC0 4.09e-64 193 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borreliella afzelii (strain PKo)
Q85BW6 5.04e-64 193 74 0 123 2 rps12 Small ribosomal subunit protein uS12c Anthoceros angustus
Q0SQD9 5.09e-64 193 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium perfringens (strain SM101 / Type A)
Q8XHR9 5.09e-64 193 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium perfringens (strain 13 / Type A)
Q0TMP1 5.09e-64 193 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q19V72 5.21e-64 193 75 0 123 3 rps12 Small ribosomal subunit protein uS12c Chlorokybus atmophyticus
C6E4R2 5.5e-64 193 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Geobacter sp. (strain M21)
B5EFP5 5.5e-64 193 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B2IK57 6.28e-64 193 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B2S090 7.9e-64 192 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia hermsii (strain HS1 / DAH)
Q46IW1 8.16e-64 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain NATL2A)
Q6B8X8 9.01e-64 192 75 0 123 3 rps12 Small ribosomal subunit protein uS12c Gracilaria tenuistipitata var. liui
Q30TP5 1.13e-63 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q890N6 1.22e-63 192 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium tetani (strain Massachusetts / E88)
A2C4U8 1.22e-63 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain NATL1A)
Q1XDJ9 1.4e-63 192 73 0 124 3 rps12 Small ribosomal subunit protein uS12c Neopyropia yezoensis
B2KEM9 1.51e-63 192 72 0 124 3 rpsL Small ribosomal subunit protein uS12 Elusimicrobium minutum (strain Pei191)
A8IAT8 1.53e-63 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q11HP7 1.9e-63 192 72 0 123 3 rpsL Small ribosomal subunit protein uS12 Chelativorans sp. (strain BNC1)
C0Q9X7 1.96e-63 192 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q28UX0 2.03e-63 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Jannaschia sp. (strain CCS1)
A0T0K4 2.16e-63 192 76 0 124 3 rps12 Small ribosomal subunit protein uS12c Phaeodactylum tricornutum (strain CCAP 1055/1)
P51289 2.31e-63 191 73 0 124 3 rps12 Small ribosomal subunit protein uS12c Porphyra purpurea
B0SUQ4 2.61e-63 191 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Caulobacter sp. (strain K31)
P19461 3.36e-63 191 73 1 123 3 rps12 Small ribosomal subunit protein uS12c Guillardia theta
B0JSE3 3.54e-63 191 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
C0ZIH3 4.13e-63 191 71 1 136 3 rpsL Small ribosomal subunit protein uS12 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
C4K4G1 4.14e-63 191 73 0 124 3 rpsL Small ribosomal subunit protein uS12 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C0QQL8 4.61e-63 191 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Persephonella marina (strain DSM 14350 / EX-H1)
Q11QA8 4.84e-63 191 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
B4UB95 4.93e-63 191 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Anaeromyxobacter sp. (strain K)
Q2IJ91 4.93e-63 191 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J856 4.93e-63 191 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B6JES8 4.93e-63 191 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q0P3M9 5.1e-63 191 73 0 124 3 rps12 Small ribosomal subunit protein uS12c Ostreococcus tauri
B5YG52 5.1e-63 191 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
P42344 5.1e-63 191 73 0 123 3 rps12 Small ribosomal subunit protein uS12c Spirogyra maxima
Q7NEF4 5.35e-63 191 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q89J79 5.45e-63 191 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8MA18 5.69e-63 191 74 0 123 3 rps12 Small ribosomal subunit protein uS12c Chaetosphaeridium globosum
B4R8L1 5.95e-63 190 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Phenylobacterium zucineum (strain HLK1)
B2A4D4 6.29e-63 190 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
P0A4A5 7.24e-63 190 73 0 123 1 rpsL Small ribosomal subunit protein uS12 Streptomyces lividans
B1W419 7.24e-63 190 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
P0A4A6 7.24e-63 190 73 0 123 1 rpsL Small ribosomal subunit protein uS12 Streptomyces filamentosus
P0A4A3 7.24e-63 190 73 0 123 1 rpsL Small ribosomal subunit protein uS12 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0A4A4 7.24e-63 190 73 0 123 1 rpsL Small ribosomal subunit protein uS12 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q6YXM6 7.49e-63 190 73 0 123 3 rps12 Small ribosomal subunit protein uS12c Physcomitrium patens
Q8RUK6 7.82e-63 190 73 0 123 3 rps12-A Small ribosomal subunit protein uS12cz/uS12cy Atropa belladonna
A5GW11 9.95e-63 190 72 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain RCC307)
B2V7L8 1.03e-62 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Sulfurihydrogenibium sp. (strain YO3AOP1)
A7GZJ6 1.09e-62 190 77 0 118 3 rpsL Small ribosomal subunit protein uS12 Campylobacter curvus (strain 525.92)
Q9MUP2 1.11e-62 190 75 0 121 3 rps12 Small ribosomal subunit protein uS12c Mesostigma viride
Q1D779 1.12e-62 190 77 0 122 3 rpsL Small ribosomal subunit protein uS12 Myxococcus xanthus (strain DK1622)
Q8KRD1 1.12e-62 190 77 0 122 3 rpsL Small ribosomal subunit protein uS12 Myxococcus xanthus
Q2IXR5 1.14e-62 190 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain HaA2)
A8ZV53 1.16e-62 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
C1A6P1 1.2e-62 190 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A4YSI7 1.24e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Bradyrhizobium sp. (strain ORS 278)
A5ELN2 1.24e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B1KSN0 1.25e-62 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ79 1.25e-62 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGF9 1.25e-62 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Okra / Type B1)
C1FMV6 1.25e-62 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Kyoto / Type A2)
A5I7L1 1.25e-62 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVQ6 1.25e-62 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ74 1.25e-62 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain ATCC 19397 / Type A)
Q9TKZ7 1.37e-62 189 76 0 121 3 rps12 Small ribosomal subunit protein uS12c Nephroselmis olivacea
A5FZW9 1.53e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Acidiphilium cryptum (strain JF-5)
Q7VA02 1.58e-62 189 70 0 124 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A0M5A2 1.76e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q0BUQ4 1.76e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P46296 1.8e-62 189 75 2 125 3 rps12 Small ribosomal subunit protein uS12c Cuscuta europaea
A9H3R9 1.86e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B0RB33 1.92e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Clavibacter sepedonicus
A5CUB9 1.92e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B8D0B9 1.96e-62 189 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q73NV5 2.03e-62 189 71 0 124 3 rpsL Small ribosomal subunit protein uS12 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q5SD27 2.03e-62 189 73 0 123 3 rps12 Small ribosomal subunit protein uS12c Huperzia lucidula
Q6MER6 2.14e-62 189 71 0 124 3 rpsL Small ribosomal subunit protein uS12 Protochlamydia amoebophila (strain UWE25)
Q211E3 2.22e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain BisB18)
Q3SSX1 2.29e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B3QBY5 2.34e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain TIE-1)
Q134S4 2.34e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain BisB5)
Q6N4T2 2.34e-62 189 73 0 123 1 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q07KL3 2.34e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain BisA53)
A6KYJ9 2.53e-62 189 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B9L7J8 2.55e-62 189 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
P06368 2.56e-62 189 72 0 123 3 rps12 Small ribosomal subunit protein uS12c Marchantia polymorpha
Q1QN35 2.58e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q8W8R9 2.76e-62 189 73 0 123 3 rps12-A Small ribosomal subunit protein uS12cz/uS12cy Psilotum nudum
Q0BYA9 2.95e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Hyphomonas neptunium (strain ATCC 15444)
B2UMU4 3.95e-62 188 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q20EW0 4.77e-62 188 72 0 122 3 rps12 Small ribosomal subunit protein uS12c Oltmannsiellopsis viridis
Q6ACY7 4.77e-62 188 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Leifsonia xyli subsp. xyli (strain CTCB07)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13805
Feature type CDS
Gene rpsL
Product 30S ribosomal protein S12
Location 3069948 - 3070322 (strand: -1)
Length 375 (nucleotides) / 124 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1684
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00164 Ribosomal protein S12/S23

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0048 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S12

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02950 small subunit ribosomal protein S12 Ribosome -

Protein Sequence

MATINQLVRKSRSSKVVKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQGRSKYGVKKPKA

Flanking regions ( +/- flanking 50bp)

ACAGAGTTCAAATCCGTGTTTACGAAGCAAAAACCAGGAGCTTTTTTTAAATGGCAACTATTAATCAGCTGGTGCGCAAATCTCGTAGCTCGAAAGTTGTTAAAAGCAACGTTCCAGCTCTGGAAGCTTGCCCGCAAAAACGTGGCGTATGTACTCGTGTATATACTACCACTCCTAAAAAACCAAACTCAGCACTGCGTAAAGTATGCCGTGTTCGTTTGACTAACGGTTTCGAAGTTTCTTCCTACATCGGTGGTGAAGGCCACAACTTGCAGGAGCACTCCGTAATCCTTATCCGTGGTGGTCGTGTTAAAGACTTACCAGGTGTGCGTTACCACACTGTTCGCGGCGCGCTGGACTGTTCCGGTGTTAAAGACCGTAAACAAGGTCGCTCTAAGTACGGTGTGAAGAAGCCAAAGGCTTAATGGTTCTCCGTTAAGTAAGGCCAAACATTTTTTCACAATTAATGTCAAAA