Homologs in group_1727

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11750 FBDBKF_11750 98.4 Morganella morganii S1 - Small ribosomal subunit protein uS12
EHELCC_14555 EHELCC_14555 98.4 Morganella morganii S2 - Small ribosomal subunit protein uS12
NLDBIP_15655 NLDBIP_15655 98.4 Morganella morganii S4 - Small ribosomal subunit protein uS12
LHKJJB_14960 LHKJJB_14960 98.4 Morganella morganii S3 - Small ribosomal subunit protein uS12
HKOGLL_19330 HKOGLL_19330 98.4 Morganella morganii S5 - Small ribosomal subunit protein uS12
PMI_RS13805 PMI_RS13805 98.4 Proteus mirabilis HI4320 rpsL 30S ribosomal protein S12

Distribution of the homologs in the orthogroup group_1727

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1727

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JIV3 2.44e-85 247 97 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664R4 2.44e-85 247 97 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CCT6 2.44e-85 247 97 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R464 2.44e-85 247 97 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJB5 2.44e-85 247 97 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis
B2K5N7 2.44e-85 247 97 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2T8 2.44e-85 247 97 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNP1 2.44e-85 247 97 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS57 2.44e-85 247 97 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4EYV9 3.24e-85 247 98 0 124 3 rpsL Small ribosomal subunit protein uS12 Proteus mirabilis (strain HI4320)
C6DG82 1.35e-84 245 96 0 124 3 rpsL Small ribosomal subunit protein uS12 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZW3 1.35e-84 245 96 0 124 3 rpsL Small ribosomal subunit protein uS12 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N9B4 2.61e-84 244 96 0 124 3 rpsL Small ribosomal subunit protein uS12 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GKK4 2.78e-84 244 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Serratia proteamaculans (strain 568)
A4TGY4 3.01e-84 244 96 0 124 3 rpsL Small ribosomal subunit protein uS12 Yersinia pestis (strain Pestoides F)
C5BGN0 4.13e-84 244 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Edwardsiella ictaluri (strain 93-146)
Q2NQL4 4.42e-84 244 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Sodalis glossinidius (strain morsitans)
A6TEY0 5.15e-84 244 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XN85 5.15e-84 244 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Klebsiella pneumoniae (strain 342)
Q3YWT0 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella sonnei (strain Ss046)
P0A7S8 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella flexneri
Q0SZX5 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella flexneri serotype 5b (strain 8401)
Q32B24 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VU7 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella boydii serotype 4 (strain Sb227)
B2U2U9 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7S6 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7S7 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella typhi
B4TXF0 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella schwarzengrund (strain CVM19633)
B5BGZ4 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella paratyphi A (strain AKU_12601)
C0Q0C4 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella paratyphi C (strain RKS4594)
Q5PIW1 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUU8 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella newport (strain SL254)
B4TKM3 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella heidelberg (strain SL476)
B5RH07 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R299 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella enteritidis PT4 (strain P125109)
B5FJM2 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella dublin (strain CT_02021853)
Q57J24 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella choleraesuis (strain SC-B67)
B5F8G0 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Salmonella agona (strain SL483)
B7LS48 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WFD5 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Enterobacter sp. (strain 638)
Q1R5U1 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain UTI89 / UPEC)
B1LHE2 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain SMS-3-5 / SECEC)
B6I242 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain SE11)
B7NDV0 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7S3 1.02e-83 243 94 0 124 1 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain K12)
B1IPV7 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7S4 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AGM9 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O1:K1 / APEC
A8A5E9 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O9:H4 (strain HS)
B7M1P3 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O8 (strain IAI1)
B7N1C3 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O81 (strain ED1a)
B7NLP7 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTP9 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7S5 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O157:H7
B7L4L7 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain 55989 / EAEC)
B7MCV7 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK52 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSL7 1.02e-83 243 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O139:H28 (strain E24377A / ETEC)
B2VK38 1.4e-83 243 95 0 124 3 rpsL Small ribosomal subunit protein uS12 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q0TCB7 2.79e-83 242 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
C4ZUJ7 2.79e-83 242 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Escherichia coli (strain K12 / MC4100 / BW2952)
B0UWC6 3.67e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Histophilus somni (strain 2336)
Q0I535 3.67e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Histophilus somni (strain 129Pt)
P63195 6.22e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Mannheimia haemolytica
P63196 6.22e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHB9 6.22e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus influenzae (strain PittGG)
A5U9Q8 6.22e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus influenzae (strain PittEE)
Q4QMT8 6.22e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus influenzae (strain 86-028NP)
B0BQZ5 6.22e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2G5 6.22e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N249 6.22e-83 241 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C4LBU6 1.23e-82 240 94 0 124 3 rpsL Small ribosomal subunit protein uS12 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A4SHV6 2.04e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Aeromonas salmonicida (strain A449)
A0KQ98 2.04e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q65W91 2.06e-82 239 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B8F7Z2 2.15e-82 239 92 0 124 3 rpsL Small ribosomal subunit protein uS12 Glaesserella parasuis serovar 5 (strain SH0165)
Q9Z6D2 2.3e-82 239 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87L43 5.06e-82 239 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MZ64 5.06e-82 239 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio campbellii (strain ATCC BAA-1116)
P45809 5.97e-82 238 93 0 124 3 rpsL Small ribosomal subunit protein uS12 Erwinia amylovora
Q9CL86 9.36e-82 238 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Pasteurella multocida (strain Pm70)
Q5F1R7 9.36e-82 238 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Glaesserella parasuis
C3LR91 1.6e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUZ9 1.6e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B5FG04 2.57e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Aliivibrio fischeri (strain MJ11)
Q5E8C1 2.57e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MH40 2.84e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio vulnificus (strain YJ016)
Q8DCR0 2.84e-81 237 91 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio vulnificus (strain CMCP6)
A5F3L3 4.3e-81 236 90 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B6EPR5 7.45e-81 236 90 0 124 3 rpsL Small ribosomal subunit protein uS12 Aliivibrio salmonicida (strain LFI1238)
B7VLG2 5.93e-80 233 90 0 124 3 rpsL Small ribosomal subunit protein uS12 Vibrio atlanticus (strain LGP32)
Q1LSY7 1.46e-78 230 90 0 124 3 rpsL Small ribosomal subunit protein uS12 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q6LVC3 1.72e-78 229 89 0 124 3 rpsL Small ribosomal subunit protein uS12 Photobacterium profundum (strain SS9)
Q47UW1 1.8e-78 229 88 0 124 3 rpsL Small ribosomal subunit protein uS12 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A3Q977 1.84e-78 229 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q5QWB6 1.88e-78 229 88 0 124 3 rpsL Small ribosomal subunit protein uS12 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0I0B0 1.02e-77 228 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sp. (strain MR-7)
Q0HNU2 1.02e-77 228 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sp. (strain MR-4)
P59166 1.02e-77 228 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8G1F3 1.53e-77 227 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sediminis (strain HAW-EB3)
Q3ILP7 1.53e-77 227 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Pseudoalteromonas translucida (strain TAC 125)
A9KW97 1.67e-77 227 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella baltica (strain OS195)
A6WHS3 1.67e-77 227 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella baltica (strain OS185)
B8EBL0 1.67e-77 227 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella baltica (strain OS223)
Q21M91 2.45e-77 227 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A8GYX1 2.62e-77 227 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TM17 2.62e-77 227 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella halifaxensis (strain HAW-EB4)
A1S213 2.8e-77 227 86 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1KMY8 3.34e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella woodyi (strain ATCC 51908 / MS32)
B8CNC7 3.34e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q089Q9 5.12e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella frigidimarina (strain NCIMB 400)
Q12SW4 6.24e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1REA9 6.59e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sp. (strain W3-18-1)
A4YBY8 6.59e-77 226 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B8D854 6.73e-77 226 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57595 6.73e-77 226 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9V2 6.73e-77 226 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A6W397 6.96e-77 226 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Marinomonas sp. (strain MWYL1)
Q31IY7 9.26e-77 225 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A0KRL9 9.46e-77 225 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Shewanella sp. (strain ANA-3)
Q9HWD0 1.37e-76 225 88 0 123 1 rpsL Small ribosomal subunit protein uS12 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T85 1.37e-76 225 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V639 1.37e-76 225 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas aeruginosa (strain LESB58)
A6UZI3 1.37e-76 225 88 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas aeruginosa (strain PA7)
A1TYJ2 2.11e-76 224 86 0 124 3 rpsL Small ribosomal subunit protein uS12 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8K947 5.42e-76 223 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q47JA8 6.53e-76 223 87 0 124 3 rpsL Small ribosomal subunit protein uS12 Dechloromonas aromatica (strain RCB)
Q15YA9 7.13e-76 223 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1R0I0 8.22e-76 223 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1KB32 1.81e-75 222 87 0 123 3 rpsL Small ribosomal subunit protein uS12 Azoarcus sp. (strain BH72)
Q8D3H4 2.57e-75 222 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Wigglesworthia glossinidia brevipalpis
B8GV63 3.03e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A4XZ95 3.03e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas mendocina (strain ymp)
Q5WZL7 3.07e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Legionella pneumophila (strain Lens)
Q5ZYP8 3.07e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHR9 3.07e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Legionella pneumophila (strain Corby)
Q5X864 3.07e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Legionella pneumophila (strain Paris)
C5BQ41 3.1e-75 221 87 0 123 3 rpsL Small ribosomal subunit protein uS12 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B0V8W3 3.14e-75 221 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain AYE)
A3M304 3.14e-75 221 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VTG5 3.14e-75 221 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain SDF)
B2HUQ2 3.14e-75 221 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain ACICU)
B7I7R9 3.14e-75 221 85 0 123 1 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain AB0057)
B7GYN0 3.14e-75 221 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baumannii (strain AB307-0294)
Q6FDS8 3.28e-75 221 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q82T68 3.74e-75 221 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2S907 4.81e-75 221 84 0 124 3 rpsL Small ribosomal subunit protein uS12 Hahella chejuensis (strain KCTC 2396)
C1DKK7 4.97e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1Q8N9 6.47e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FQG3 6.47e-75 221 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q0AIK0 1.2e-74 220 84 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q5P337 1.2e-74 220 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A5WGL2 1.25e-74 220 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Psychrobacter sp. (strain PRwf-1)
A4VHM5 1.36e-74 220 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Stutzerimonas stutzeri (strain A1501)
A1T059 1.51e-74 220 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q89A65 1.54e-74 219 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q0VSM0 2.05e-74 219 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B1JDW9 2.07e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas putida (strain W619)
Q88QP0 2.07e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXP2 2.07e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFX1 2.07e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas entomophila (strain L48)
Q4ZMN9 2.55e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas syringae pv. syringae (strain B728a)
Q889X6 2.55e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C3K2Y1 2.55e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas fluorescens (strain SBW25)
Q48D31 2.55e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B3R7T3 3.32e-74 219 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K609 3.32e-74 219 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q7NQE8 3.7e-74 219 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q46WD8 4.41e-74 219 84 0 124 3 rpsL Small ribosomal subunit protein uS12 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B0KK62 4.77e-74 218 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas putida (strain GB-1)
C1DAR2 4.82e-74 218 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Laribacter hongkongensis (strain HLHK9)
Q2YB02 5.26e-74 218 85 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3K5Y3 6e-74 218 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas fluorescens (strain Pf0-1)
Q4K528 6e-74 218 86 0 123 3 rpsL Small ribosomal subunit protein uS12 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3SLQ4 7.39e-74 218 83 0 123 3 rpsL Small ribosomal subunit protein uS12 Thiobacillus denitrificans (strain ATCC 25259)
Q1H4P2 8.62e-74 218 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q056Z9 9.01e-74 218 86 0 124 3 rpsL Small ribosomal subunit protein uS12 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q1LI27 1.32e-73 218 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2UEM4 7.65e-73 216 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Ralstonia pickettii (strain 12J)
Q8XV08 7.65e-73 216 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1KRG8 7.74e-73 215 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66375 7.74e-73 215 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66374 7.74e-73 215 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3X2 7.74e-73 215 85 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria meningitidis serogroup C (strain 053442)
Q3J8Q9 1.38e-72 215 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q605A7 1.72e-72 214 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5F5S1 1.9e-72 214 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9BPR3 3.88e-72 214 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Delftia acidovorans (strain DSM 14801 / SPH-1)
A5CXN5 5.11e-72 213 83 0 123 3 rpsL Small ribosomal subunit protein uS12 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q492A9 5.22e-72 213 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Blochmanniella pennsylvanica (strain BPEN)
B0U0Z3 5.64e-72 213 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A0Q4H9 5.82e-72 213 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. novicida (strain U112)
B5ELX4 6.15e-72 213 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J462 6.15e-72 213 84 0 123 3 rpsL Small ribosomal subunit protein uS12 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q0ABI0 8.94e-72 213 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1W2Q2 9.23e-72 213 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Acidovorax sp. (strain JS42)
B9MB68 9.23e-72 213 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Acidovorax ebreus (strain TPSY)
Q7VRN7 1.39e-71 212 83 0 124 3 rpsL Small ribosomal subunit protein uS12 Blochmanniella floridana
A5EX68 1.48e-71 212 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Dichelobacter nodosus (strain VCS1703A)
A4SUV6 2.86e-71 211 82 0 123 3 rpsL Small ribosomal subunit protein uS12 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1WVC7 4.84e-71 211 81 0 123 3 rpsL Small ribosomal subunit protein uS12 Halorhodospira halophila (strain DSM 244 / SL1)
A6T3K9 6.87e-71 211 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Janthinobacterium sp. (strain Marseille)
A4G9U3 6.87e-71 211 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Herminiimonas arsenicoxydans
A9IJ10 7.34e-71 211 81 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2SU22 7.84e-71 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q06 7.84e-71 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia pseudomallei (strain K96243)
A3NEI4 7.84e-71 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia pseudomallei (strain 668)
Q3JMQ7 7.84e-71 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia pseudomallei (strain 1710b)
A3P0B8 7.84e-71 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia pseudomallei (strain 1106a)
Q13TG5 1.04e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Paraburkholderia xenovorans (strain LB400)
A4IZT8 1.11e-70 210 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHX2 1.11e-70 210 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNT1 1.11e-70 210 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. holarctica (strain OSU18)
B2SDY9 1.11e-70 210 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5H4 1.11e-70 210 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. holarctica (strain LVS)
A7N9S2 1.11e-70 210 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JC4 1.11e-70 210 82 0 124 3 rpsL Small ribosomal subunit protein uS12 Francisella tularensis subsp. tularensis (strain FSC 198)
Q7VTD7 1.13e-70 210 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2G0 1.13e-70 210 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRC9 1.13e-70 210 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2L2H8 1.13e-70 210 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Bordetella avium (strain 197N)
B2JIH1 1.14e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JAN5 1.34e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BRU3 1.34e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia orbicola (strain AU 1054)
B1JU17 1.34e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia orbicola (strain MC0-3)
A9ADI8 1.34e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39KH2 1.34e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ51 1.34e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5B5 1.34e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3M0 1.34e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia cenocepacia (strain HI2424)
B1YRC5 1.34e-70 210 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia ambifaria (strain MC40-6)
Q2RQV5 1.47e-70 209 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2W2I6 1.5e-70 209 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A1AVJ5 1.69e-70 209 82 0 123 3 rpsL Small ribosomal subunit protein uS12 Ruthia magnifica subsp. Calyptogena magnifica
B2T756 1.89e-70 209 81 0 124 3 rpsL Small ribosomal subunit protein uS12 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1V8A8 2.22e-70 209 80 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia mallei (strain SAVP1)
Q62GK0 2.22e-70 209 80 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia mallei (strain ATCC 23344)
A2S7H1 2.22e-70 209 80 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia mallei (strain NCTC 10229)
A3MRU9 2.22e-70 209 80 0 124 3 rpsL Small ribosomal subunit protein uS12 Burkholderia mallei (strain NCTC 10247)
Q21RV3 8.39e-70 208 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B1Y7G7 1.95e-69 207 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1VIP5 2.51e-69 206 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Polaromonas naphthalenivorans (strain CJ2)
B2FQ40 2.84e-69 206 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Stenotrophomonas maltophilia (strain K279a)
B4SKV8 2.84e-69 206 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Stenotrophomonas maltophilia (strain R551-3)
B1XSP6 2.9e-69 206 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q3A9R0 3.81e-69 206 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A7HWQ6 4.65e-69 206 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A1TJ02 5.91e-69 206 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Paracidovorax citrulli (strain AAC00-1)
A2SLG2 7.52e-69 205 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q83ES9 8.87e-69 205 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KD36 8.87e-69 205 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Coxiella burnetii (strain Dugway 5J108-111)
Q12GX6 1.22e-68 205 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q8PC54 2.69e-68 204 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URD4 2.69e-68 204 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas campestris pv. campestris (strain 8004)
Q0ANP5 3.46e-68 204 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Maricaulis maris (strain MCS10)
A1WHC0 4.5e-68 203 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Verminephrobacter eiseniae (strain EF01-2)
B6IRQ1 4.97e-68 203 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodospirillum centenum (strain ATCC 51521 / SW)
A9NAL9 5.48e-68 203 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Coxiella burnetii (strain RSA 331 / Henzerling II)
P66380 6.53e-68 203 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5X5 6.53e-68 203 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xylella fastidiosa (strain M12)
P66379 6.53e-68 203 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xylella fastidiosa (strain 9a5c)
Q39Y11 6.54e-68 203 82 0 123 3 rpsL Small ribosomal subunit protein uS12 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
C5CP60 1.13e-67 202 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Variovorax paradoxus (strain S110)
A0L5W8 1.21e-67 202 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q5GWS8 1.29e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQQ3 1.29e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZY0 1.29e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWY9 1.29e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNS8 1.29e-67 202 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Xanthomonas axonopodis pv. citri (strain 306)
P63194 1.79e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella suis biovar 1 (strain 1330)
B0CH37 1.79e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VR11 1.79e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8GH23 1.79e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJK6 1.79e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5Q5 1.79e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CQ3 1.79e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella abortus biovar 1 (strain 9-941)
Q2YLZ8 1.79e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella abortus (strain 2308)
B2S684 1.79e-67 202 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella abortus (strain S19)
Q3B6G6 2.09e-67 202 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B2TIH0 2.36e-67 202 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYA5 2.36e-67 202 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Alaska E43 / Type E3)
C6C181 2.6e-67 201 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B3QR56 3.53e-67 201 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
C4XLW8 4.04e-67 201 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A1BJ39 6.51e-67 201 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q3APG8 6.58e-67 201 79 0 124 3 rpsL Small ribosomal subunit protein uS12 Chlorobium chlorochromatii (strain CaD3)
A6LPQ6 6.83e-67 200 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A6X0B3 7.14e-67 200 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A6U854 8.51e-67 200 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Sinorhizobium medicae (strain WSM419)
B9JDS4 8.51e-67 200 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q8UE13 8.51e-67 200 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Agrobacterium fabrum (strain C58 / ATCC 33970)
B1ZLJ9 1.41e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W4P6 1.41e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylorubrum extorquens (strain PA1)
B7L0Q6 1.41e-66 199 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B5ZYT0 1.49e-66 199 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B3PW62 1.49e-66 199 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium etli (strain CIAT 652)
B8DN92 1.74e-66 199 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
C3MAX5 2.34e-66 199 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q92QH4 2.34e-66 199 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium meliloti (strain 1021)
B4SBU2 2.43e-66 199 78 0 124 3 rpsL Small ribosomal subunit protein uS12 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B8IS80 2.88e-66 199 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A8LM43 2.88e-66 199 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
P17294 3.04e-66 199 76 0 124 3 rps12 Small ribosomal subunit protein uS12c Cyanophora paradoxa
O50563 3.07e-66 199 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Thiomonas delicata
Q1GP94 3.11e-66 199 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A0RQI2 3.58e-66 199 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Campylobacter fetus subsp. fetus (strain 82-40)
Q1MIE6 4.13e-66 198 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K9M1 4.13e-66 198 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A9IW34 4.32e-66 198 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q8KNX8 4.87e-66 198 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B9M6V0 6.2e-66 198 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A1USK9 6.2e-66 198 77 0 123 3 rpsL1 Small ribosomal subunit protein uS12 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q1GK44 6.48e-66 198 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Ruegeria sp. (strain TM1040)
A8EW88 6.61e-66 198 76 0 124 3 rpsL Small ribosomal subunit protein uS12 Aliarcobacter butzleri (strain RM4018)
Q3AW56 6.91e-66 198 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain CC9902)
B1LWS1 8.07e-66 197 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A4SCQ4 8.86e-66 198 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A5GAY3 9.61e-66 197 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Geotalea uraniireducens (strain Rf4)
Q3A6Q2 1.12e-65 197 80 0 123 3 rpsL Small ribosomal subunit protein uS12 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q98N61 1.12e-65 197 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B0UHX4 1.15e-65 197 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylobacterium sp. (strain 4-46)
B4S5N2 1.16e-65 197 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q2JMY0 1.39e-65 197 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain JA-2-3B'a(2-13))
A5GIP3 1.44e-65 197 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain WH7803)
Q2JUX7 1.47e-65 197 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain JA-3-3Ab)
A4WVL3 1.47e-65 197 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J5S7 1.47e-65 197 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGJ2 1.47e-65 197 77 0 123 3 rpsL1 Small ribosomal subunit protein uS12 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q118Z5 1.52e-65 197 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Trichodesmium erythraeum (strain IMS101)
A8Z6I5 1.6e-65 197 76 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter concisus (strain 13826)
Q5HVX8 1.73e-65 197 76 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni (strain RM1221)
A1VYJ6 1.73e-65 197 76 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PI18 1.73e-65 197 76 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H4P7 1.73e-65 197 76 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FKR5 1.75e-65 197 76 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5LMR2 1.9e-65 197 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B8J3F7 1.92e-65 197 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q2G8Y5 1.94e-65 197 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B9KFG9 2.09e-65 197 76 0 124 3 rpsL Small ribosomal subunit protein uS12 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A5V607 2.26e-65 196 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q30Z36 2.31e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A7IFX6 2.36e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q6FZB7 2.39e-65 196 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Bartonella quintana (strain Toulouse)
B2IK57 2.5e-65 196 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q160Y1 2.58e-65 196 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A1ALT6 2.61e-65 196 79 0 123 3 rpsL Small ribosomal subunit protein uS12 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A1B021 2.73e-65 196 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Paracoccus denitrificans (strain Pd 1222)
A6Q6I4 2.85e-65 196 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Sulfurovum sp. (strain NBC37-1)
B8H416 3.01e-65 196 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A3K2 3.01e-65 196 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B3EP66 3.86e-65 196 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Chlorobium phaeobacteroides (strain BS1)
Q0ID56 4.09e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain CC9311)
A4J106 4.56e-65 196 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q3AMT3 4.61e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain CC9605)
Q7U4D4 4.87e-65 196 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Parasynechococcus marenigrum (strain WH8102)
Q2N9A5 5.38e-65 196 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Erythrobacter litoralis (strain HTCC2594)
A7I3T8 6.34e-65 195 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A8IAT8 6.92e-65 195 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B1WQY7 8.43e-65 195 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Crocosphaera subtropica (strain ATCC 51142 / BH68)
P56354 9.21e-65 195 76 0 123 3 rps12 Small ribosomal subunit protein uS12c Chlorella vulgaris
Q01W87 1.13e-64 195 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Solibacter usitatus (strain Ellin6076)
A6Q1M5 1.15e-64 195 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Nitratiruptor sp. (strain SB155-2)
Q28UX0 1.27e-64 194 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Jannaschia sp. (strain CCS1)
Q11HP7 1.28e-64 194 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Chelativorans sp. (strain BNC1)
Q6AP76 1.35e-64 194 77 0 122 3 rpsL Small ribosomal subunit protein uS12 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
P63199 1.76e-64 194 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P63200 1.76e-64 194 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q97EH2 1.78e-64 194 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A1QZH5 2.07e-64 194 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia turicatae (strain 91E135)
B5RRJ5 2.07e-64 194 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia recurrentis (strain A1)
B5RLU7 2.07e-64 194 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia duttonii (strain Ly)
B3EH96 2.18e-64 194 77 0 121 3 rpsL Small ribosomal subunit protein uS12 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q8KAG8 2.3e-64 194 78 0 120 3 rpsL Small ribosomal subunit protein uS12 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B0SUQ4 2.37e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Caulobacter sp. (strain K31)
B3E7T0 2.47e-64 194 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B3QY19 2.66e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q0AUH5 2.69e-64 194 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
C6E4R2 2.85e-64 194 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Geobacter sp. (strain M21)
B5EFP5 2.85e-64 194 78 0 123 3 rpsL Small ribosomal subunit protein uS12 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B6JES8 2.88e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q89J79 3.08e-64 194 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q661N1 3.18e-64 194 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
B7J1V9 3.18e-64 194 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borreliella burgdorferi (strain ZS7)
O51348 3.18e-64 194 75 0 124 1 rpsL Small ribosomal subunit protein uS12 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q0SNC0 3.18e-64 194 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Borreliella afzelii (strain PKo)
A5D5I5 3.21e-64 194 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B4R8L1 3.25e-64 194 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Phenylobacterium zucineum (strain HLK1)
Q46IW1 3.28e-64 194 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain NATL2A)
B7K837 3.51e-64 194 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Gloeothece citriformis (strain PCC 7424)
A0T0Z8 3.71e-64 193 77 0 124 3 rps12 Small ribosomal subunit protein uS12c Thalassiosira pseudonana
Q6B8X8 4.47e-64 193 76 0 123 3 rps12 Small ribosomal subunit protein uS12c Gracilaria tenuistipitata var. liui
B7JUP8 4.71e-64 193 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Rippkaea orientalis (strain PCC 8801 / RF-1)
A0PXU1 4.71e-64 193 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium novyi (strain NT)
A2C4U8 5.26e-64 193 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain NATL1A)
P74230 5.74e-64 193 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B8FET9 5.94e-64 193 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulfatibacillum aliphaticivorans
B2S090 6e-64 193 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Borrelia hermsii (strain HS1 / DAH)
Q1MPT1 6.28e-64 193 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Lawsonia intracellularis (strain PHE/MN1-00)
A4YSI7 6.28e-64 193 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Bradyrhizobium sp. (strain ORS 278)
A5ELN2 6.28e-64 193 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q30TP5 6.33e-64 193 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A0LII6 7.16e-64 192 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q2IXR5 7.73e-64 192 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain HaA2)
Q1ISC7 8.07e-64 192 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Koribacter versatilis (strain Ellin345)
Q1XDJ9 8.16e-64 192 74 0 124 3 rps12 Small ribosomal subunit protein uS12c Neopyropia yezoensis
B8HVS0 8.66e-64 193 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B2J5A8 9.39e-64 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A1VEC1 9.63e-64 192 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CI5 9.63e-64 192 77 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q32S12 1.13e-63 192 75 0 123 3 rps12 Small ribosomal subunit protein uS12c Staurastrum punctulatum
P51289 1.24e-63 192 74 0 124 3 rps12 Small ribosomal subunit protein uS12c Porphyra purpurea
Q3MDM2 1.35e-63 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YP60 1.35e-63 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q211E3 1.41e-63 192 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain BisB18)
B3QBY5 1.44e-63 192 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain TIE-1)
Q134S4 1.44e-63 192 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain BisB5)
Q6N4T2 1.44e-63 192 74 0 123 1 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q07KL3 1.44e-63 192 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Rhodopseudomonas palustris (strain BisA53)
Q1QN35 1.59e-63 192 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SSX1 1.76e-63 192 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B1XI66 1.78e-63 192 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P19461 1.94e-63 192 73 1 123 3 rps12 Small ribosomal subunit protein uS12c Guillardia theta
P59168 2.65e-63 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
C0QQL8 2.73e-63 191 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Persephonella marina (strain DSM 14350 / EX-H1)
Q0BYA9 2.73e-63 191 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Hyphomonas neptunium (strain ATCC 15444)
Q7NEF4 2.86e-63 192 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q32RQ9 3.05e-63 191 74 0 123 3 rps12 Small ribosomal subunit protein uS12c Zygnema circumcarinatum
A7HBL4 3.15e-63 191 77 0 122 3 rpsL Small ribosomal subunit protein uS12 Anaeromyxobacter sp. (strain Fw109-5)
Q890N6 3.21e-63 191 76 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium tetani (strain Massachusetts / E88)
Q2S3R9 3.29e-63 191 72 0 123 3 rpsL Small ribosomal subunit protein uS12 Salinibacter ruber (strain DSM 13855 / M31)
B0CCD3 3.29e-63 191 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Acaryochloris marina (strain MBIC 11017)
Q11QA8 3.48e-63 191 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
P13576 3.87e-63 191 72 0 124 3 rpsL Small ribosomal subunit protein uS12 Arthrospira platensis
B5YG52 3.96e-63 191 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B8ELG8 4.05e-63 191 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B0TC51 4.38e-63 191 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A5GW11 4.67e-63 191 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Synechococcus sp. (strain RCC307)
Q0P3M9 4.93e-63 191 74 0 124 3 rps12 Small ribosomal subunit protein uS12c Ostreococcus tauri
Q4G344 5.38e-63 191 75 0 124 3 rps12 Small ribosomal subunit protein uS12c Emiliania huxleyi
C4K4G1 5.56e-63 191 73 0 124 3 rpsL Small ribosomal subunit protein uS12 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A5N4P2 5.94e-63 191 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q9MUP2 5.95e-63 190 76 0 121 3 rps12 Small ribosomal subunit protein uS12c Mesostigma viride
B2V7L8 6.58e-63 191 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Sulfurihydrogenibium sp. (strain YO3AOP1)
A2T357 6.71e-63 190 73 0 123 3 rps12-A Small ribosomal subunit protein uS12cz/uS12cy Angiopteris evecta
B1I1I3 7.08e-63 190 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulforudis audaxviator (strain MP104C)
Q1D779 7.09e-63 190 77 0 122 3 rpsL Small ribosomal subunit protein uS12 Myxococcus xanthus (strain DK1622)
Q8KRD1 7.09e-63 190 77 0 122 3 rpsL Small ribosomal subunit protein uS12 Myxococcus xanthus
B0JSE3 7.14e-63 190 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
C1A6P1 7.94e-63 191 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q9TKZ7 8.62e-63 190 77 0 121 3 rps12 Small ribosomal subunit protein uS12c Nephroselmis olivacea
Q2RFP2 8.82e-63 190 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q85BW6 1.03e-62 190 73 0 123 2 rps12 Small ribosomal subunit protein uS12c Anthoceros angustus
B1KSN0 1.09e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ79 1.09e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGF9 1.09e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Okra / Type B1)
C1FMV6 1.09e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Kyoto / Type A2)
A5I7L1 1.09e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVQ6 1.09e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ74 1.09e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium botulinum (strain ATCC 19397 / Type A)
Q19V72 1.14e-62 190 74 0 123 3 rps12 Small ribosomal subunit protein uS12c Chlorokybus atmophyticus
A7GZJ6 1.22e-62 190 77 0 118 3 rpsL Small ribosomal subunit protein uS12 Campylobacter curvus (strain 525.92)
Q0SQD9 1.24e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium perfringens (strain SM101 / Type A)
Q8XHR9 1.24e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium perfringens (strain 13 / Type A)
Q0TMP1 1.24e-62 190 75 0 123 3 rpsL Small ribosomal subunit protein uS12 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B9L7J8 1.29e-62 190 75 0 124 3 rpsL Small ribosomal subunit protein uS12 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
P0A4A5 1.37e-62 189 73 0 123 1 rpsL Small ribosomal subunit protein uS12 Streptomyces lividans
B1W419 1.37e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
P0A4A6 1.37e-62 189 73 0 123 1 rpsL Small ribosomal subunit protein uS12 Streptomyces filamentosus
P0A4A3 1.37e-62 189 73 0 123 1 rpsL Small ribosomal subunit protein uS12 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0A4A4 1.37e-62 189 73 0 123 1 rpsL Small ribosomal subunit protein uS12 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q6MER6 1.51e-62 189 71 0 124 3 rpsL Small ribosomal subunit protein uS12 Protochlamydia amoebophila (strain UWE25)
A0M5A2 2.44e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q7VA02 2.53e-62 189 70 0 124 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A5FZW9 2.76e-62 189 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Acidiphilium cryptum (strain JF-5)
P35643 3.27e-62 187 90 0 98 3 rpsL Small ribosomal subunit protein uS12 (Fragment) Eikenella corrodens
A9H3R9 3.48e-62 188 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A6KYJ9 3.84e-62 189 74 0 124 3 rpsL Small ribosomal subunit protein uS12 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B0RB33 4.28e-62 188 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Clavibacter sepedonicus
A5CUB9 4.28e-62 188 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
C0Q9X7 4.38e-62 188 74 0 123 3 rpsL Small ribosomal subunit protein uS12 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q0BUQ4 4.52e-62 188 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q9Z800 4.57e-62 188 72 0 123 3 rpsL Small ribosomal subunit protein uS12 Chlamydia pneumoniae
A2BT86 4.62e-62 188 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain AS9601)
A8G711 4.62e-62 188 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain MIT 9215)
B2KEM9 5.09e-62 188 71 0 124 3 rpsL Small ribosomal subunit protein uS12 Elusimicrobium minutum (strain Pei191)
A9BCK3 5.27e-62 188 72 0 123 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain MIT 9211)
A0T0K4 5.32e-62 188 75 0 124 3 rps12 Small ribosomal subunit protein uS12c Phaeodactylum tricornutum (strain CCAP 1055/1)
Q7V503 6.27e-62 188 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain MIT 9313)
A2CC84 6.27e-62 188 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Prochlorococcus marinus (strain MIT 9303)
Q253E9 6.49e-62 188 71 0 123 3 rpsL Small ribosomal subunit protein uS12 Chlamydia felis (strain Fe/C-56)
Q824G2 6.49e-62 188 71 0 123 3 rpsL Small ribosomal subunit protein uS12 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q5L6S7 6.49e-62 188 71 0 123 3 rpsL Small ribosomal subunit protein uS12 Chlamydia abortus (strain DSM 27085 / S26/3)
C0ZIH3 8.15e-62 188 70 1 136 3 rpsL Small ribosomal subunit protein uS12 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q6NJD8 8.17e-62 187 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
P42344 1.01e-61 187 73 0 123 3 rps12 Small ribosomal subunit protein uS12c Spirogyra maxima
B2A4D4 1.02e-61 187 75 0 121 3 rpsL Small ribosomal subunit protein uS12 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B4UB95 1.24e-61 187 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Anaeromyxobacter sp. (strain K)
Q2IJ91 1.24e-61 187 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J856 1.24e-61 187 76 0 121 3 rpsL Small ribosomal subunit protein uS12 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q6ACY7 1.28e-61 187 73 0 123 3 rpsL Small ribosomal subunit protein uS12 Leifsonia xyli subsp. xyli (strain CTCB07)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14910
Feature type CDS
Gene rpsL
Product 30S ribosomal protein S12
Location 214900 - 215274 (strand: 1)
Length 375 (nucleotides) / 124 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1727
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00164 Ribosomal protein S12/S23

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0048 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S12

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02950 small subunit ribosomal protein S12 Ribosome -

Protein Sequence

MATINQLVRKPRSSKVVKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGVKKPKA

Flanking regions ( +/- flanking 50bp)

GAGGTACAAATCCGTGTTTACGAAGCAAAAAACCAGGAGCTTTTTTTATAATGGCAACGATTAATCAGCTGGTTCGCAAACCACGTAGCTCGAAAGTTGTGAAAAGCAACGTTCCTGCACTGGAAGCCTGCCCGCAAAAACGTGGCGTATGTACCCGTGTATATACCACCACACCTAAAAAACCTAACTCAGCACTGCGTAAAGTCTGCCGTGTTCGTTTAACCAACGGTTTTGAAGTTTCTTCATACATCGGTGGTGAAGGCCATAACCTGCAGGAGCACAGCGTGATCCTGATCCGTGGTGGTCGTGTTAAAGACTTACCAGGTGTTCGCTACCACACAGTTCGTGGCGCACTGGACTGCTCAGGTGTTAAAGACCGCAAACAGTCCCGTTCCAAGTACGGTGTGAAGAAGCCTAAGGCTTAATGGTTCTCCGTTAAGTAAGGCCAAACATTTATCGCATTAATGTCAAATAA