Homologs in group_380

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19050 FBDBKF_19050 32.0 Morganella morganii S1 paaY Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
EHELCC_18795 EHELCC_18795 32.0 Morganella morganii S2 paaY Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
NLDBIP_18810 NLDBIP_18810 32.0 Morganella morganii S4 paaY Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
LHKJJB_18665 LHKJJB_18665 32.0 Morganella morganii S3 paaY Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
HKOGLL_18400 HKOGLL_18400 32.0 Morganella morganii S5 paaY Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
F4V73_RS19115 F4V73_RS19115 34.8 Morganella psychrotolerans - gamma carbonic anhydrase family protein
PMI_RS16340 PMI_RS16340 32.2 Proteus mirabilis HI4320 - gamma carbonic anhydrase family protein

Distribution of the homologs in the orthogroup group_380

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_380

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8GB16 2.19e-143 400 98 0 197 3 caiE Carnitine operon protein CaiE Proteus sp. (strain LE138)
B5FHG3 1.88e-117 334 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella dublin (strain CT_02021853)
A8ALR8 3.2e-117 333 80 0 195 3 caiE Carnitine operon protein CaiE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4TWR2 3.58e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella schwarzengrund (strain CVM19633)
B5BL53 3.58e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella paratyphi A (strain AKU_12601)
C0Q4L1 3.58e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella paratyphi C (strain RKS4594)
Q5PIL2 3.58e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T6J4 3.58e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella newport (strain SL254)
B4TIG8 3.58e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella heidelberg (strain SL476)
B5RGA3 3.58e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1Q8 3.58e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella enteritidis PT4 (strain P125109)
Q8Z9L6 6.13e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella typhi
B5F748 6.27e-117 333 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella agona (strain SL483)
Q8ZRX6 1.44e-116 332 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57TJ2 3.51e-116 331 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella choleraesuis (strain SC-B67)
A9MYJ4 8.81e-116 330 77 0 195 3 caiE Carnitine operon protein CaiE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5YYC9 1.04e-113 325 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA36 1.04e-113 325 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O157:H7
B7UI81 4.44e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z5X4 5.18e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Shigella sonnei (strain Ss046)
A7ZVY5 5.18e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O9:H4 (strain HS)
B7M0D2 5.18e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O8 (strain IAI1)
B7L4F8 5.18e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli (strain 55989 / EAEC)
A7ZHC6 5.18e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83SQ8 5.65e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Shigella flexneri
Q0T8F9 5.65e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Shigella flexneri serotype 5b (strain 8401)
B7N7R0 6.74e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7MNP2 6.74e-113 323 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O81 (strain ED1a)
P39206 6.96e-113 322 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli (strain K12)
B1XBG0 6.96e-113 322 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli (strain K12 / DH10B)
C4ZPW1 6.96e-113 322 77 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli (strain K12 / MC4100 / BW2952)
B1LFW8 7.94e-113 322 76 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli (strain SMS-3-5 / SECEC)
Q1RGG3 1.32e-112 322 76 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli (strain UTI89 / UPEC)
Q8FLA7 1.32e-112 322 76 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLV4 1.32e-112 322 76 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A785 1.32e-112 322 76 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O1:K1 / APEC
B7MAF8 1.32e-112 322 76 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NHD9 1.36e-112 322 76 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1IRE1 4.39e-112 320 76 0 195 3 caiE Carnitine operon protein CaiE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q32K62 1.36e-111 319 76 0 195 3 caiE Carnitine operon protein CaiE Shigella dysenteriae serotype 1 (strain Sd197)
B7LWM6 2.01e-109 314 75 0 195 3 caiE Carnitine operon protein CaiE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P77181 4.92e-77 232 54 0 195 3 paaY Phenylacetic acid degradation protein PaaY Escherichia coli (strain K12)
P40882 3.91e-25 99 36 0 159 3 PA3753 Uncharacterized protein PA3753 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5KW03 1.2e-24 98 31 0 165 1 GK2848 Carbonic anhydrase Geobacillus kaustophilus (strain HTA426)
Q57752 1e-23 95 34 0 145 3 MJ0304 Probable carbonic anhydrase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O34696 1.36e-23 95 32 0 165 3 ytoA Uncharacterized transferase YtoA Bacillus subtilis (strain 168)
Q9C6B3 3.03e-23 96 32 2 158 1 GAMMACA2 Gamma carbonic anhydrase 2, mitochondrial Arabidopsis thaliana
Q9FWR5 3.35e-22 94 31 2 158 1 GAMMACA1 Gamma carbonic anhydrase 1, mitochondrial Arabidopsis thaliana
P0A9X0 9.16e-21 88 30 4 181 3 yrdA Protein YrdA Shigella flexneri
P0A9W9 9.16e-21 88 30 4 181 1 yrdA Protein YrdA Escherichia coli (strain K12)
Q94AU7 1.12e-19 87 30 2 158 1 GAMMACA3 Gamma carbonic anhydrase 3, mitochondrial Arabidopsis thaliana
Q9FMV1 3.97e-16 77 28 1 145 1 GAMMACAL1 Gamma carbonic anhydrase-like 1, mitochondrial Arabidopsis thaliana
Q9SMN1 1.78e-15 75 27 1 145 1 GAMMACAL2 Gamma carbonic anhydrase-like 2, mitochondrial Arabidopsis thaliana
Q54JC2 3.67e-14 71 29 1 151 1 DDB_G0288155 Uncharacterized protein DDB_G0288155 Dictyostelium discoideum
P40881 1.43e-11 64 34 3 117 1 MSTHT_0588 Carbonic anhydrase Methanosarcina thermophila (strain ATCC 43570 / DSM 1825 / OCM 12 / VKM B-1830 / TM-1)
O30711 9.16e-10 60 33 5 125 3 ccmM Carboxysome assembly protein CcmM Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q8YYI3 2.81e-09 59 31 4 122 1 ccmM Carboxysome assembly protein CcmM Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8DKB5 1.08e-07 54 31 3 110 1 ccmM Carboxysome assembly protein CcmM Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A6LUD2 2.81e-07 52 30 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q03YE4 2.94e-07 52 32 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B7JUM7 4.53e-07 52 34 3 100 3 lpxD UDP-3-O-acylglucosamine N-acyltransferase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q3MEX5 1.7e-06 50 33 4 103 3 lpxD UDP-3-O-acylglucosamine N-acyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q03513 2.18e-06 50 30 4 124 1 ccmM Carboxysome assembly protein CcmM Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8YSL0 2.48e-06 50 33 4 103 3 lpxD UDP-3-O-acylglucosamine N-acyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P72758 3.2e-06 50 31 4 123 1 ccmM Carboxysome assembly protein CcmM Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B2IUM5 4.16e-06 49 30 4 104 3 lpxD UDP-3-O-acylglucosamine N-acyltransferase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B9DVY7 7.05e-06 48 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q03IN0 7.76e-06 48 29 5 148 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2I4 7.76e-06 48 29 5 148 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXY2 7.76e-06 48 29 5 148 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus thermophilus (strain CNRZ 1066)
B1MZN0 8.98e-06 48 30 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Leuconostoc citreum (strain KM20)
Q97GI6 9.09e-06 48 28 7 156 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2V5B7 9.44e-06 48 29 6 148 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain Alaska E43 / Type E3)
C1CU00 1.16e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CH25 1.72e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae (strain JJA)
Q8DN54 1.72e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IN15 1.72e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae (strain CGSP14)
B8ZPL9 1.72e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I9G3 1.72e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae (strain Hungary19A-6)
C1CAS4 1.72e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae (strain 70585)
B5E3A4 1.72e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae serotype 19F (strain G54)
Q04I77 1.72e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
C1CN43 1.74e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae (strain P1031)
Q97NE6 1.74e-05 47 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B2TS78 1.76e-05 47 30 6 148 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain Eklund 17B / Type B)
Q032G9 1.85e-05 47 27 7 162 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Lactococcus lactis subsp. cremoris (strain SK11)
B3W7E7 2.19e-05 47 28 5 142 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Lacticaseibacillus casei (strain BL23)
Q03CW1 2.39e-05 47 28 5 142 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8ERA4 3.18e-05 46 31 5 141 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A8AUL9 3.3e-05 46 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A3CQT5 3.36e-05 46 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus sanguinis (strain SK36)
A2RI05 5.39e-05 46 27 7 162 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Lactococcus lactis subsp. cremoris (strain MG1363)
A4VY24 5.47e-05 45 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus suis (strain 05ZYH33)
A4W4B5 5.47e-05 45 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus suis (strain 98HAH33)
B0JUA2 5.63e-05 46 33 3 103 3 lpxD UDP-3-O-acylglucosamine N-acyltransferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q7VC79 6.37e-05 46 30 4 113 3 lpxD UDP-3-O-acylglucosamine N-acyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q8DVY7 6.43e-05 45 28 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9CIS5 7.64e-05 45 27 5 146 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
B6EJW8 0.000113 45 32 2 103 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Aliivibrio salmonicida (strain LFI1238)
A5I6N5 0.000123 45 29 7 162 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FYA5 0.000123 45 29 7 162 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain ATCC 19397 / Type A)
B7IF15 0.000131 44 26 5 168 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Thermosipho africanus (strain TCF52B)
C1FL32 0.000178 44 29 7 162 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain Kyoto / Type A2)
B1IMX1 0.000181 44 27 7 162 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain Okra / Type B1)
B1L0V4 0.000197 44 28 7 162 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain Loch Maree / Type A3)
Q3AYS2 0.000205 44 27 3 109 3 lpxD UDP-3-O-acylglucosamine N-acyltransferase Synechococcus sp. (strain CC9902)
Q88V23 0.000236 44 27 6 144 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C3KTL7 0.00025 43 28 7 162 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain 657 / Type Ba4)
A7GI22 0.000262 43 27 7 162 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B2G6M7 0.001 42 27 5 143 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ56 0.001 42 27 5 143 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Limosilactobacillus reuteri (strain DSM 20016)
Q3AIH3 0.001 42 28 4 112 3 lpxD UDP-3-O-acylglucosamine N-acyltransferase Synechococcus sp. (strain CC9605)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13100
Feature type CDS
Gene caiE
Product carnitine operon protein CaiE
Location 2909018 - 2909611 (strand: 1)
Length 594 (nucleotides) / 197 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_380
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00132 Bacterial transferase hexapeptide (six repeats)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0663 General function prediction only (R) R Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08279 carnitine operon protein CaiE - -

Protein Sequence

MSIYAFEGVIPVVHPTAYIHPSAVLIGDVIIGAGVYIGPLASLRGDYGRLIVEAGANLQDGCVMHGYTDMDTIVQENGHIGHGAILHSCIIGRDSLVGMNSVIMDGAIIGEESIVAAMSFVKAGFQGQARQMLMGSPAKHVRDISDQDMQWKRMNTREYQDLTVRYRQSLVETTPLTAPEANRPRLRGTTEVKPKGQ

Flanking regions ( +/- flanking 50bp)

AAGGACGGTAATTATCACTTGAATTGATAATACAACTAAGAGGAAAACTGATGAGTATCTATGCATTTGAAGGTGTTATTCCTGTTGTTCATCCAACAGCTTACATTCACCCATCAGCAGTACTAATTGGCGATGTCATTATTGGTGCTGGTGTTTATATTGGCCCTTTGGCTTCATTACGGGGTGATTATGGCCGTTTAATTGTTGAAGCAGGTGCAAATCTTCAAGATGGCTGTGTTATGCATGGTTATACGGATATGGATACCATTGTGCAAGAAAATGGTCATATTGGTCATGGTGCTATTCTTCACAGTTGTATTATCGGTCGTGATAGCCTAGTCGGCATGAATAGCGTGATTATGGATGGTGCGATCATTGGTGAGGAAAGTATTGTTGCTGCCATGAGCTTTGTGAAAGCGGGCTTTCAAGGTCAGGCGAGACAAATGTTAATGGGAAGCCCAGCAAAACATGTACGTGATATTAGCGACCAAGATATGCAATGGAAACGTATGAACACTCGTGAATATCAAGATCTCACTGTTCGTTATCGTCAAAGCTTAGTTGAAACCACACCATTAACAGCCCCTGAAGCTAATCGTCCTCGTTTAAGAGGCACGACAGAAGTAAAACCCAAAGGCCAATAAACCAACAGCGACAGGCACAACAAACGCCTGTCGTATTGCTTTATTTTAAC