Homologs in group_380

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19050 FBDBKF_19050 100.0 Morganella morganii S1 paaY Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
EHELCC_18795 EHELCC_18795 100.0 Morganella morganii S2 paaY Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
LHKJJB_18665 LHKJJB_18665 100.0 Morganella morganii S3 paaY Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
HKOGLL_18400 HKOGLL_18400 100.0 Morganella morganii S5 paaY Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
F4V73_RS19115 F4V73_RS19115 92.6 Morganella psychrotolerans - gamma carbonic anhydrase family protein
PMI_RS13100 PMI_RS13100 32.0 Proteus mirabilis HI4320 caiE carnitine operon protein CaiE
PMI_RS16340 PMI_RS16340 68.3 Proteus mirabilis HI4320 - gamma carbonic anhydrase family protein

Distribution of the homologs in the orthogroup group_380

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_380

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9X0 6.28e-98 283 77 0 177 3 yrdA Protein YrdA Shigella flexneri
P0A9W9 6.28e-98 283 77 0 177 1 yrdA Protein YrdA Escherichia coli (strain K12)
Q9C6B3 2.78e-37 132 42 2 172 1 GAMMACA2 Gamma carbonic anhydrase 2, mitochondrial Arabidopsis thaliana
Q9FWR5 3.35e-37 132 43 1 157 1 GAMMACA1 Gamma carbonic anhydrase 1, mitochondrial Arabidopsis thaliana
O34696 1.95e-35 124 40 1 169 3 ytoA Uncharacterized transferase YtoA Bacillus subtilis (strain 168)
Q5KW03 3.07e-34 122 42 2 163 1 GK2848 Carbonic anhydrase Geobacillus kaustophilus (strain HTA426)
P40882 9.95e-33 118 41 1 155 3 PA3753 Uncharacterized protein PA3753 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q57752 2.79e-32 116 41 1 155 3 MJ0304 Probable carbonic anhydrase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q94AU7 1.34e-28 109 37 2 159 1 GAMMACA3 Gamma carbonic anhydrase 3, mitochondrial Arabidopsis thaliana
P77181 4.47e-26 101 36 2 161 3 paaY Phenylacetic acid degradation protein PaaY Escherichia coli (strain K12)
B1LFW8 1.58e-25 100 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli (strain SMS-3-5 / SECEC)
Q1RGG3 2.09e-25 99 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli (strain UTI89 / UPEC)
Q8FLA7 2.09e-25 99 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLV4 2.09e-25 99 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A785 2.09e-25 99 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O1:K1 / APEC
B7MAF8 2.09e-25 99 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UI81 2.14e-25 99 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7N7R0 2.16e-25 99 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7MNP2 2.16e-25 99 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O81 (strain ED1a)
P39206 5.72e-25 98 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli (strain K12)
B1XBG0 5.72e-25 98 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli (strain K12 / DH10B)
C4ZPW1 5.72e-25 98 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli (strain K12 / MC4100 / BW2952)
B7NHD9 6.1e-25 98 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q54JC2 1.34e-24 99 36 2 160 1 DDB_G0288155 Uncharacterized protein DDB_G0288155 Dictyostelium discoideum
Q3Z5X4 1.72e-24 97 36 1 158 3 caiE Carnitine operon protein CaiE Shigella sonnei (strain Ss046)
A7ZVY5 1.72e-24 97 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O9:H4 (strain HS)
B7M0D2 1.72e-24 97 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O8 (strain IAI1)
B7L4F8 1.72e-24 97 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli (strain 55989 / EAEC)
A7ZHC6 1.72e-24 97 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O139:H28 (strain E24377A / ETEC)
B5YYC9 1.74e-24 97 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA36 1.74e-24 97 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli O157:H7
Q83SQ8 2.4e-24 97 36 1 158 3 caiE Carnitine operon protein CaiE Shigella flexneri
Q0T8F9 2.4e-24 97 36 1 158 3 caiE Carnitine operon protein CaiE Shigella flexneri serotype 5b (strain 8401)
B1IRE1 3.63e-24 96 36 1 158 3 caiE Carnitine operon protein CaiE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7LWM6 4.7e-24 96 35 1 161 3 caiE Carnitine operon protein CaiE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q9FMV1 1.17e-23 96 38 2 147 1 GAMMACAL1 Gamma carbonic anhydrase-like 1, mitochondrial Arabidopsis thaliana
Q32K62 3.42e-23 94 35 1 158 3 caiE Carnitine operon protein CaiE Shigella dysenteriae serotype 1 (strain Sd197)
Q9SMN1 7.44e-23 94 36 2 147 1 GAMMACAL2 Gamma carbonic anhydrase-like 2, mitochondrial Arabidopsis thaliana
B5FHG3 2.46e-22 92 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella dublin (strain CT_02021853)
B4TWR2 2.65e-22 92 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella schwarzengrund (strain CVM19633)
B5BL53 2.65e-22 92 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella paratyphi A (strain AKU_12601)
C0Q4L1 2.65e-22 92 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella paratyphi C (strain RKS4594)
Q5PIL2 2.65e-22 92 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T6J4 2.65e-22 92 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella newport (strain SL254)
B4TIG8 2.65e-22 92 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella heidelberg (strain SL476)
B5RGA3 2.65e-22 92 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1Q8 2.65e-22 92 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella enteritidis PT4 (strain P125109)
Q8Z9L6 5.47e-22 90 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella typhi
B5F748 6.63e-22 90 32 1 158 3 caiE Carnitine operon protein CaiE Salmonella agona (strain SL483)
Q8ZRX6 6.77e-22 90 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57TJ2 1.07e-21 90 33 1 158 3 caiE Carnitine operon protein CaiE Salmonella choleraesuis (strain SC-B67)
A9MYJ4 5.61e-21 88 32 1 158 3 caiE Carnitine operon protein CaiE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q8GB16 2.53e-20 86 33 2 156 3 caiE Carnitine operon protein CaiE Proteus sp. (strain LE138)
A8ALR8 2.08e-19 84 32 1 158 3 caiE Carnitine operon protein CaiE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8DKB5 1.14e-10 62 32 5 143 1 ccmM Carboxysome assembly protein CcmM Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P40881 5.56e-08 54 25 8 191 1 MSTHT_0588 Carbonic anhydrase Methanosarcina thermophila (strain ATCC 43570 / DSM 1825 / OCM 12 / VKM B-1830 / TM-1)
Q03513 1.68e-06 50 28 6 154 1 ccmM Carboxysome assembly protein CcmM Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q54XU5 2e-06 49 25 2 129 3 dynE Dynactin subunit 5 Dictyostelium discoideum
Q8YYI3 5.9e-06 48 29 4 124 1 ccmM Carboxysome assembly protein CcmM Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q820F0 1.14e-05 47 28 6 156 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q5L723 2.03e-05 47 27 6 156 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Chlamydia abortus (strain DSM 27085 / S26/3)
P39856 2.89e-05 45 38 2 65 3 capG Protein CapG Staphylococcus aureus
P39856 0.000348 42 32 3 103 3 capG Protein CapG Staphylococcus aureus
A1B8X9 2.98e-05 46 26 4 150 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Paracoccus denitrificans (strain Pd 1222)
B3PYQ2 5.41e-05 45 26 4 145 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Rhizobium etli (strain CIAT 652)
Q252V0 6.66e-05 45 26 6 156 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Chlamydia felis (strain Fe/C-56)
P71405 7.38e-05 44 41 2 77 3 cysE Serine acetyltransferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q1MH44 8.05e-05 45 26 4 145 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B5ZN93 0.000138 44 26 4 145 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q118R6 0.000165 44 30 7 153 3 glmU Bifunctional protein GlmU Trichodesmium erythraeum (strain IMS101)
Q7NA96 0.000174 44 30 2 102 3 glmU Bifunctional protein GlmU Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2K8X7 0.000178 44 26 4 145 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9ZK14 0.000195 43 40 2 77 3 cysE Serine acetyltransferase Helicobacter pylori (strain J99 / ATCC 700824)
Q5X0C0 0.000244 43 45 0 51 3 lpxD1 UDP-3-O-acylglucosamine N-acyltransferase 1 Legionella pneumophila (strain Lens)
Q5ZZB1 0.000255 43 45 0 51 3 lpxD1 UDP-3-O-acylglucosamine N-acyltransferase 1 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X8X9 0.000255 43 45 0 51 3 lpxD1 UDP-3-O-acylglucosamine N-acyltransferase 1 Legionella pneumophila (strain Paris)
Q92Q45 0.000288 43 26 5 148 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Rhizobium meliloti (strain 1021)
A0A5K6CNB8 0.000314 43 32 0 67 1 posA Delta-poly-L-ornithine synthetase Acinetobacter baumannii (strain AB307-0294)
Q03YE4 0.000376 43 26 3 120 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B2TS78 0.000443 43 26 4 132 3 dapH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Clostridium botulinum (strain Eklund 17B / Type B)
C3MBR2 0.000474 43 26 4 145 3 lpxA Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9N3F1 0.000543 42 25 1 128 3 dnc-6 Dynactin subunit 6 Caenorhabditis elegans

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18810
Feature type CDS
Gene paaY
Product Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily
Location 396 - 938 (strand: 1)
Length 543 (nucleotides) / 180 (amino acids)
In genomic island -

Contig

Accession ZDB_544
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_380
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00132 Bacterial transferase hexapeptide (six repeats)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0663 General function prediction only (R) R Carbonic anhydrase or acetyltransferase, isoleucine patch superfamily

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01726 gamma-carbonic anhydrase [EC:4.2.1.-] - -

Protein Sequence

MNKLRPYLTLTPSVGKNVMIDDSSVIIGDVRLADDVGIWPLVVARGDVNYIQIGQRTNIQDGSVLHVTHQTADNPAGHPLIIGEDVTVGHKVMLHGCTIGNRVLVGMGSILLDGVVVEDDVIIGAGSLVSPGKRLESGYLYLGSPAKAVRPLKPEEYEGLKYSANNYVMWKNNYLSQGNR

Flanking regions ( +/- flanking 50bp)

ACTCTCTCATTAAGATCACCAAAATACATTTATATTCTGAGGTAATTATTGTGAATAAACTCCGTCCCTATCTGACATTAACCCCTTCTGTCGGTAAAAATGTCATGATCGATGACTCCTCCGTCATTATCGGTGATGTGCGTCTGGCTGATGATGTCGGTATCTGGCCGCTGGTTGTTGCCCGGGGAGATGTCAATTACATTCAGATTGGTCAGCGTACCAATATTCAGGACGGCTCCGTATTACATGTCACTCACCAGACAGCAGATAACCCGGCCGGTCACCCGCTGATTATCGGTGAGGATGTTACCGTCGGCCATAAAGTGATGCTGCACGGCTGCACTATCGGTAACCGTGTCCTGGTCGGTATGGGTTCAATCCTGCTGGACGGAGTGGTGGTAGAGGATGATGTAATTATCGGCGCGGGCAGTCTGGTCTCTCCCGGCAAACGTCTGGAAAGCGGCTACCTGTATCTCGGCAGCCCTGCCAAAGCCGTCCGTCCGCTGAAACCGGAAGAATATGAAGGGCTGAAATATTCAGCCAATAACTATGTTATGTGGAAAAATAATTATCTGTCACAGGGCAACCGGTAAGGCGGCTCATCCGCCTCACCTTTTTCAATGAATTCCGCAAACTCTTCCTC