Homologs in group_2666

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04005 FBDBKF_04005 100.0 Morganella morganii S1 - Integrating conjugative element protein
EHELCC_06530 EHELCC_06530 100.0 Morganella morganii S2 - Integrating conjugative element protein
NLDBIP_06855 NLDBIP_06855 100.0 Morganella morganii S4 - Integrating conjugative element protein
LHKJJB_06390 LHKJJB_06390 100.0 Morganella morganii S3 - Integrating conjugative element protein
HKOGLL_04540 HKOGLL_04540 100.0 Morganella morganii S5 - Integrating conjugative element protein

Distribution of the homologs in the orthogroup group_2666

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2666

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12760
Feature type CDS
Gene -
Product TIGR03758 family integrating conjugative element protein
Location 2821930 - 2822169 (strand: -1)
Length 240 (nucleotides) / 79 (amino acids)
In genomic island GI60

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2666
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF11660 Protein of unknown function (DUF3262)

Protein Sequence

MNPSQQAAFEAAAGSGMSPAVLNLLCIGALLAVLFLWAAWGLVDVYRGWANENVRTARVGQFAVRAVILLVVCIWMFAS

Flanking regions ( +/- flanking 50bp)

CCGGTTAATGTGGCGGAGCCGCTGCGCGGGGATTACCGCCGGGAGCAGCGATGAATCCGTCACAGCAGGCGGCATTTGAGGCTGCTGCCGGCTCGGGGATGTCTCCGGCTGTTCTGAATCTGTTGTGTATCGGGGCATTACTGGCGGTGCTGTTTTTATGGGCAGCCTGGGGACTGGTTGATGTTTACCGGGGCTGGGCAAATGAAAATGTTCGTACTGCAAGGGTGGGGCAGTTTGCTGTCCGGGCAGTGATATTACTGGTGGTCTGCATCTGGATGTTTGCCAGTTGAGTGTGCTGTTTAATTTATTTTACAGAATGAAAGGTCATTTTATGGATATG