Homologs in group_2666

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06530 EHELCC_06530 100.0 Morganella morganii S2 - Integrating conjugative element protein
NLDBIP_06855 NLDBIP_06855 100.0 Morganella morganii S4 - Integrating conjugative element protein
LHKJJB_06390 LHKJJB_06390 100.0 Morganella morganii S3 - Integrating conjugative element protein
HKOGLL_04540 HKOGLL_04540 100.0 Morganella morganii S5 - Integrating conjugative element protein
PMI_RS12760 PMI_RS12760 100.0 Proteus mirabilis HI4320 - TIGR03758 family integrating conjugative element protein

Distribution of the homologs in the orthogroup group_2666

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2666

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_04005
Feature type CDS
Gene -
Product Integrating conjugative element protein
Location 199006 - 199245 (strand: -1)
Length 240 (nucleotides) / 79 (amino acids)
In genomic island -

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2666
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF11660 Protein of unknown function (DUF3262)

Protein Sequence

MNPSQQAAFEAAAGSGMSPAVLNLLCIGALLAVLFLWAAWGLVDVYRGWANENVRTARVGQFAVRAVILLVVCIWMFAS

Flanking regions ( +/- flanking 50bp)

CCGGTTAATGTGGCGGAGCCGCTGCGCGGGGATTACCGCCGGGAGCAGCGATGAATCCGTCACAGCAGGCGGCATTTGAGGCTGCTGCCGGCTCGGGGATGTCTCCGGCTGTTCTGAATCTGTTGTGTATCGGGGCATTACTGGCGGTGCTGTTTTTATGGGCAGCCTGGGGACTGGTTGATGTTTACCGGGGCTGGGCAAATGAAAATGTTCGTACTGCAAGGGTGGGGCAGTTTGCTGTCCGGGCAGTGATATTACTGGTGGTCTGCATCTGGATGTTTGCCAGTTGAGTGTGCTGTTTAATTTATTTTACAGAATGAAAGGTCATTTTATGGATATG