Homologs in group_1164

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06680 FBDBKF_06680 69.4 Morganella morganii S1 dppC ABC-type dipeptide/oligopeptide/nickel transport system, permease component
EHELCC_09725 EHELCC_09725 69.4 Morganella morganii S2 dppC ABC-type dipeptide/oligopeptide/nickel transport system, permease component
NLDBIP_10105 NLDBIP_10105 69.4 Morganella morganii S4 dppC ABC-type dipeptide/oligopeptide/nickel transport system, permease component
LHKJJB_07650 LHKJJB_07650 69.4 Morganella morganii S3 dppC ABC-type dipeptide/oligopeptide/nickel transport system, permease component
HKOGLL_07200 HKOGLL_07200 69.4 Morganella morganii S5 dppC ABC-type dipeptide/oligopeptide/nickel transport system, permease component
F4V73_RS15260 F4V73_RS15260 69.4 Morganella psychrotolerans - ABC transporter permease

Distribution of the homologs in the orthogroup group_1164

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1164

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8FUW9 3.42e-33 125 34 1 223 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
Q8YDG8 3.68e-33 125 34 1 223 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 3.68e-33 125 34 1 223 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 3.68e-33 125 34 1 223 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
P26904 2.21e-32 124 30 2 259 2 dppC Dipeptide transport system permease protein DppC Bacillus subtilis (strain 168)
P94312 6.64e-32 122 33 3 225 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P0A4N0 1.66e-29 116 31 0 202 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M9 1.66e-29 116 31 0 202 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P24139 1.57e-28 113 32 2 215 1 oppC Oligopeptide transport system permease protein OppC Bacillus subtilis (strain 168)
Q8FWN9 1.46e-27 110 29 2 256 3 BRA0407 Putative peptide permease protein BRA0407/BS1330_II0404 Brucella suis biovar 1 (strain 1330)
A5VU89 8.88e-27 108 29 2 256 3 BOV_A0350 Putative peptide permease protein BOV_A0350 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YBN8 1.29e-26 108 29 2 256 3 BMEII0861 Putative peptide permease protein BMEII0861 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YK65 1.29e-26 108 29 2 256 3 BAB2_0815 Putative peptide permease protein BAB2_0815 Brucella abortus (strain 2308)
Q577J7 1.29e-26 108 29 2 256 3 BruAb2_0794 Putative peptide permease protein BruAb2_0794 Brucella abortus biovar 1 (strain 9-941)
Q53192 1.71e-26 107 30 1 235 3 NGR_a01420 Probable peptide ABC transporter permease protein y4tQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P42063 4.1e-26 107 31 3 246 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)
P77463 1.11e-22 97 26 2 241 1 ddpC Probable D,D-dipeptide transport system permease protein DdpC Escherichia coli (strain K12)
A0A0H2ZFV0 1.42e-22 97 33 4 219 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
P75799 3.3e-22 96 29 2 227 1 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain K12)
Q8FJK8 3.41e-22 96 28 4 253 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJL6 3.41e-22 96 28 4 253 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z3V1 3.66e-22 96 29 2 227 3 gsiD Glutathione transport system permease protein GsiD Shigella sonnei (strain Ss046)
Q323W2 3.66e-22 96 29 2 227 3 gsiD Glutathione transport system permease protein GsiD Shigella boydii serotype 4 (strain Sb227)
Q8X6V6 3.66e-22 96 29 2 227 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O157:H7
Q32IB8 9.54e-22 95 29 2 227 3 gsiD Glutathione transport system permease protein GsiD Shigella dysenteriae serotype 1 (strain Sd197)
Q83S25 1.24e-21 95 29 2 227 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri
P0C2L2 1.24e-21 95 29 2 227 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri serotype 5b (strain 8401)
Q1RE93 1.38e-21 94 29 2 227 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain UTI89 / UPEC)
A1A971 1.38e-21 94 29 2 227 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O1:K1 / APEC
Q7CQV4 3.33e-21 94 26 2 248 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF88 3.33e-21 94 26 2 248 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhi
Q5PGP6 3.33e-21 94 26 2 248 3 gsiD Glutathione transport system permease protein GsiD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RA9 3.33e-21 94 26 2 248 3 gsiD Glutathione transport system permease protein GsiD Salmonella choleraesuis (strain SC-B67)
P0AFA9 4.56e-21 92 29 2 228 1 nikC Nickel transport system permease protein NikC Escherichia coli (strain K12)
P0AFB0 4.56e-21 92 29 2 228 3 nikC Nickel transport system permease protein NikC Escherichia coli O157:H7
P66965 4.78e-20 90 30 5 242 3 BQ2027_MB1313C Putative peptide transport permease protein Mb1313c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ9 4.78e-20 90 30 5 242 1 Rv1282c Putative peptide transport permease protein Rv1282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ8 4.78e-20 90 30 5 242 3 MT1319 Putative peptide transport permease protein MT1319 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6D3B2 1.5e-19 89 26 2 227 3 gsiD Glutathione transport system permease protein GsiD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P51000 1.32e-16 80 28 2 215 3 dppC Dipeptide transport system permease protein DppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H3JU73 1.84e-16 80 26 2 217 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FVE9 1.86e-16 80 26 2 217 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain NCTC 8325 / PS 47)
P45053 2.26e-16 80 28 3 226 3 oppC Oligopeptide transport system permease protein OppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A2RI76 1.9e-14 75 25 3 236 1 dppC Dipeptide transport system permease protein DppC Lactococcus lactis subsp. cremoris (strain MG1363)
P08006 2.94e-13 71 25 3 226 1 oppC Oligopeptide transport system permease protein OppC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45287 2.18e-12 69 27 3 218 3 sapC Peptide transport system permease protein SapC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AEG1 3.71e-12 68 29 3 257 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 3.71e-12 68 29 3 257 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 3.71e-12 68 29 3 257 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
P0AGH7 5.86e-12 67 25 3 225 3 sapC Peptide transport system permease protein SapC Shigella flexneri
P0AGH5 5.86e-12 67 25 3 225 1 sapC Putrescine export system permease protein SapC Escherichia coli (strain K12)
P0AGH6 5.86e-12 67 25 3 225 3 sapC Peptide transport system permease protein SapC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7D203 5.68e-11 65 28 3 209 3 yejE Peptidoglycan transport system permease protein YejE Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A2J5 1.75e-10 63 24 4 256 2 sapC Peptide transport system permease protein SapC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J6 1.75e-10 63 24 4 256 3 sapC Peptide transport system permease protein SapC Salmonella typhi
Q7A0Y0 3.77e-10 62 23 4 223 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MW2)
Q6G9H9 3.77e-10 62 23 4 223 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MSSA476)
Q5HG39 3.77e-10 62 23 4 223 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain COL)
Q2FYQ6 3.77e-10 62 23 4 223 1 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH56 3.77e-10 62 23 4 223 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain USA300)
P33915 6.13e-10 62 28 5 188 1 yejE Inner membrane ABC transporter permease protein YejE Escherichia coli (strain K12)
Q2YXY8 7.79e-10 61 23 4 223 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A5Q7 8.82e-10 61 23 4 223 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain N315)
Q99UA1 8.82e-10 61 23 4 223 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GH26 1.46e-09 60 23 6 224 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MRSA252)
P0AFH6 2.72e-09 60 25 3 231 1 oppC Oligopeptide transport system permease protein OppC Escherichia coli (strain K12)
P0AFH7 2.72e-09 60 25 3 231 3 oppC Oligopeptide transport system permease protein OppC Escherichia coli O157:H7
P0A4P0 4.78e-09 59 23 4 219 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N9 1.17e-08 58 23 4 219 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
P75553 5.25e-08 56 26 4 181 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47324 1.95e-05 48 23 4 181 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12430
Feature type CDS
Gene -
Product ABC transporter permease
Location 2756381 - 2757193 (strand: -1)
Length 813 (nucleotides) / 270 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1164
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1173 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)		 EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Protein Sequence

MIYDPNKPLFRLLFVSIVLVGLVIYGLSVSHTDIVMDFLARNQAPSTQYWFGTDNLGRSLWLRCFQGMLSSLNIGVTSAVVSGAIALIFAGISSINRHCDLLVRGVVDALLALPHLLLLILICFTLGGGQQGVIWAVALTHWPKLALILRGEIQRIREADYVMLSRRIGNTPFECVKKHYIPMLLPQWIVGTLLMFPHAVLHSAALSFLGFGQAAHEPSLGLLLADALRYLSTGAWWMVFFPGLILMCLVLIFDQFAKAMQQLWLRGAGC

Flanking regions ( +/- flanking 50bp)

ATCTCTAACTACTTGTTACGACGAATTAATAAAGGAATTTTGCGCGACTTATGATTTACGATCCCAATAAGCCTTTATTTAGACTGCTATTTGTCTCAATCGTATTAGTGGGGCTGGTTATTTATGGCTTATCTGTTTCTCATACTGATATTGTGATGGATTTTTTAGCTAGAAACCAAGCGCCATCAACTCAGTACTGGTTTGGCACGGATAATTTAGGCCGTTCACTGTGGTTACGCTGTTTTCAAGGTATGTTAAGTAGCTTAAATATCGGTGTCACTAGTGCCGTTGTCAGTGGTGCTATTGCTTTGATATTTGCTGGGATCTCCTCCATTAATCGCCATTGTGATTTATTGGTCAGAGGGGTGGTTGATGCCTTGTTAGCATTACCTCATTTACTGTTGTTGATCTTGATCTGTTTTACTTTAGGTGGGGGACAGCAAGGTGTTATCTGGGCTGTTGCATTAACCCATTGGCCCAAATTAGCCCTAATTTTACGTGGTGAAATTCAACGTATTCGTGAAGCAGATTATGTGATGCTATCTCGCCGTATTGGCAATACACCTTTTGAGTGTGTGAAAAAACACTATATCCCAATGTTATTACCGCAATGGATTGTAGGAACGTTGCTTATGTTTCCACATGCGGTATTGCATAGTGCTGCGTTGAGCTTTTTAGGTTTTGGGCAAGCAGCGCATGAGCCTTCTCTTGGATTGCTATTAGCGGATGCCTTACGTTATTTAAGTACCGGTGCTTGGTGGATGGTGTTTTTTCCCGGATTAATTTTAATGTGCTTGGTATTGATATTTGATCAATTTGCTAAAGCCATGCAACAACTATGGTTAAGAGGGGCAGGATGTTAAGTTTTGAACAGCTTTCCATTGATATTGCGCAGTTTCGTTGGTTAGGAAAG