Homologs in group_2354

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17845 FBDBKF_17845 70.6 Morganella morganii S1 dppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
EHELCC_09870 EHELCC_09870 70.6 Morganella morganii S2 dppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
NLDBIP_10250 NLDBIP_10250 70.6 Morganella morganii S4 dppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
LHKJJB_07505 LHKJJB_07505 70.6 Morganella morganii S3 dppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
HKOGLL_07055 HKOGLL_07055 70.6 Morganella morganii S5 dppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
F4V73_RS15120 F4V73_RS15120 70.6 Morganella psychrotolerans - ATP-binding cassette domain-containing protein

Distribution of the homologs in the orthogroup group_2354

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2354

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P42065 4.4e-25 102 31 2 193 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
Q53194 5.3e-24 100 33 4 195 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
C0SP98 5.58e-22 94 28 5 219 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
Q8FJL0 1.89e-21 94 31 2 192 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FJL0 4.84e-13 70 27 6 229 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P37313 2.18e-21 92 29 2 193 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
Q0SBZ1 2.24e-21 93 31 4 183 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhodococcus jostii (strain RHA1)
Q323W5 3.53e-21 94 32 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q323W5 1.04e-13 72 28 5 207 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q0T6D3 3.6e-21 94 32 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q0T6D3 7.71e-13 69 28 5 210 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q83LT3 3.63e-21 94 32 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q83LT3 1.21e-12 69 28 5 207 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q32IB5 4e-21 94 32 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q32IB5 1.15e-13 72 28 5 207 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z3V4 4.04e-21 94 32 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q3Z3V4 1.28e-13 72 28 5 207 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
P75796 4.12e-21 94 32 3 192 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P75796 1.26e-13 72 28 5 207 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
Q5PGP3 4.49e-21 93 31 4 197 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGP3 1.54e-11 65 26 4 206 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZQM4 4.94e-21 93 31 4 197 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQM4 1.66e-11 65 26 4 206 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z864 4.94e-21 93 31 4 197 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8Z864 3.1e-11 65 26 4 206 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q57RB2 4.94e-21 93 31 4 197 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q57RB2 1.6e-11 65 26 4 206 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q0S0Z3 6.87e-21 91 31 4 183 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
Q8YCN7 9.49e-21 90 30 5 211 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 9.49e-21 90 30 5 211 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 9.49e-21 90 30 5 211 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
A0A0H2ZH52 1.23e-20 90 30 3 194 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8FVN0 1.41e-20 89 30 5 211 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q0RYP7 1.53e-20 90 31 4 183 3 fbpC3 Fe(3+) ions import ATP-binding protein FbpC 3 Rhodococcus jostii (strain RHA1)
Q2LVM2 1.61e-20 88 30 4 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Syntrophus aciditrophicus (strain SB)
Q6D3A9 1.71e-20 92 31 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3A9 8.01e-13 69 27 5 211 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8X6W1 1.86e-20 92 31 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8X6W1 1.15e-13 72 28 5 207 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q1RE96 1.9e-20 92 31 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q1RE96 1.11e-13 72 27 6 229 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q0TJM0 1.97e-20 91 31 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJM0 1.19e-13 72 27 6 229 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8YBN5 2.23e-20 90 28 3 216 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 2.23e-20 90 28 3 216 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 2.23e-20 90 28 3 216 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 2.23e-20 90 28 3 216 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 2.23e-20 90 28 3 216 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P24137 2.56e-20 89 28 2 195 1 oppF Oligopeptide transport ATP-binding protein OppF Bacillus subtilis (strain 168)
P45051 3.62e-20 89 31 3 194 3 oppF Oligopeptide transport ATP-binding protein OppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1R5D8 2.29e-19 86 28 2 204 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 2.29e-19 86 28 2 204 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 2.29e-19 86 28 2 204 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q2YXZ0 3.43e-19 85 29 4 192 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain bovine RF122 / ET3-1)
P45094 3.76e-19 86 26 2 193 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P33594 3.92e-19 85 28 2 204 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q3YW48 3.96e-19 85 28 2 204 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q32AQ1 4.04e-19 85 28 2 204 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
Q2YJJ8 4.35e-19 86 32 5 196 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 4.35e-19 86 32 5 196 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
A1A967 7.12e-19 87 31 3 192 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
A1A967 1.18e-13 72 27 6 229 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
Q5WUF8 7.14e-19 84 29 4 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Lens)
Q32EX7 1.05e-18 84 30 4 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q6GH28 1.11e-18 84 28 4 192 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MRSA252)
Q5HG41 1.22e-18 84 29 4 192 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain COL)
Q2FYQ8 1.22e-18 84 29 4 192 1 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH58 1.22e-18 84 29 4 192 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain USA300)
Q2YAD6 1.23e-18 85 28 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8NWT6 1.3e-18 83 29 4 192 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MW2)
Q6G9I1 1.3e-18 83 29 4 192 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MSSA476)
Q9CN78 1.5e-18 83 29 4 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pasteurella multocida (strain Pm70)
Q57QD7 1.55e-18 83 30 4 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
Q31ZH4 1.59e-18 83 31 5 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella boydii serotype 4 (strain Sb227)
Q3Z300 1.78e-18 83 30 4 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 1.78e-18 83 30 4 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 1.78e-18 83 30 4 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 1.78e-18 83 30 4 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P75957 1.8e-18 83 30 4 197 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
Q5X2Z8 1.96e-18 83 28 4 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Paris)
P33916 2.05e-18 85 32 5 188 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 2.34e-15 77 29 8 231 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P61482 2.06e-18 83 30 4 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61481 2.06e-18 83 30 4 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
Q5PGR6 2.06e-18 83 30 4 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7A5Q9 2.33e-18 83 27 3 192 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain N315)
Q99UA3 2.33e-18 83 27 3 192 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8YDH1 2.36e-18 85 32 5 196 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q31VE6 2.81e-18 83 28 2 204 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q5ZT78 3.01e-18 82 29 4 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q2RS22 3.13e-18 83 27 4 209 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q39T41 3.22e-18 82 26 2 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P72479 3.65e-18 84 29 4 196 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8X4L6 4.56e-18 82 28 2 204 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
Q5QU46 7.12e-18 81 29 4 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q2FVF1 7.37e-18 82 30 2 176 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q3ATY5 8.91e-18 81 27 2 195 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Chlorobium chlorochromatii (strain CaD3)
Q6D2F6 9.03e-18 83 30 5 197 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9CKL2 1.43e-17 83 31 9 235 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A9CKL2 6.57e-16 78 27 4 204 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
Q7NQN5 1.56e-17 82 30 6 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8P2L5 1.6e-17 82 26 3 204 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0CZ33 1.65e-17 82 26 3 204 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XDU4 1.65e-17 82 26 3 204 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ32 1.65e-17 82 26 3 204 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V6 1.65e-17 82 26 3 204 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M1
A2RI78 1.87e-17 82 29 6 201 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
Q8X8E3 2.13e-17 80 30 4 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O157:H7
Q83J77 2.26e-17 80 27 2 204 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
Q28VN1 2.73e-17 80 26 4 205 3 znuC Zinc import ATP-binding protein ZnuC Jannaschia sp. (strain CCS1)
P77279 2.86e-17 80 28 3 196 1 fetA Probable iron export ATP-binding protein FetA Escherichia coli (strain K12)
P57383 3.35e-17 79 31 5 190 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q83RS0 3.72e-17 79 31 5 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella flexneri
P77622 3.83e-17 80 29 4 188 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
Q0SZJ3 3.89e-17 80 27 2 204 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q74AT2 4.05e-17 79 27 3 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8P4S7 5.67e-17 80 27 4 203 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 5.67e-17 80 27 4 203 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
P0AAI0 5.68e-17 80 25 3 200 3 sapF Peptide transport system ATP-binding protein SapF Shigella flexneri
P0AAH8 5.68e-17 80 25 3 200 1 sapF Putrescine export system ATP-binding protein SapF Escherichia coli (strain K12)
P0AAH9 5.68e-17 80 25 3 200 3 sapF Peptide transport system ATP-binding protein SapF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q2FNX9 6.75e-17 79 28 6 217 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q68W38 7.61e-17 78 28 4 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q0AU85 8.14e-17 80 28 4 202 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q9EYM2 8.87e-17 78 28 3 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P10346 8.88e-17 79 26 5 202 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
A0A0H3JT74 9.03e-17 79 29 2 176 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q82TL6 1.58e-16 79 28 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q04F14 1.82e-16 79 26 2 198 3 metN1 Methionine import ATP-binding protein MetN 1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
O34641 2e-16 79 28 7 216 2 ytrB ABC transporter ATP-binding protein YtrB Bacillus subtilis (strain 168)
Q50966 3.03e-16 79 29 4 201 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
Q5FKL2 3.14e-16 79 28 4 223 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
P45092 3.51e-16 77 29 5 204 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45247 3.63e-16 77 27 3 193 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKQ9 3.63e-16 77 27 3 193 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain 86-028NP)
Q2SPI3 3.82e-16 77 28 7 204 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Hahella chejuensis (strain KCTC 2396)
P77737 4.23e-16 78 29 4 193 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
P36638 5.54e-16 77 24 3 200 2 sapF Peptide transport system ATP-binding protein SapF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q88WA5 6.18e-16 78 26 3 207 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q0AGF4 6.56e-16 78 30 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q81J15 6.81e-16 77 29 4 184 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P08007 6.82e-16 77 29 2 193 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q72Y96 7.4e-16 77 28 6 202 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q815Y7 7.48e-16 77 28 6 202 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5KVK2 8.74e-16 77 28 6 202 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
P18766 9.23e-16 77 25 2 204 3 amiF Oligopeptide transport ATP-binding protein AmiF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q4KC87 9.57e-16 77 32 6 179 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8PGE8 1.01e-15 77 28 6 207 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q21TG3 1.05e-15 75 28 3 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q7MJ01 1.07e-15 75 27 3 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio vulnificus (strain YJ016)
Q8DAV6 1.07e-15 75 27 3 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio vulnificus (strain CMCP6)
Q97UY8 1.19e-15 77 29 6 213 1 glcV Glucose import ATP-binding protein GlcV Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q88HL0 1.25e-15 76 30 4 203 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q73F66 1.27e-15 76 28 4 200 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q15TB1 1.32e-15 75 28 3 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q03P57 1.33e-15 77 27 4 198 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q2FVF0 1.41e-15 76 26 6 221 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q4QND5 1.44e-15 76 27 5 205 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus influenzae (strain 86-028NP)
Q83F44 1.49e-15 77 26 3 211 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q6HBS0 1.54e-15 77 27 6 202 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q5E0B3 1.6e-15 75 26 5 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9PF03 1.6e-15 76 28 6 199 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain 9a5c)
P31134 1.74e-15 77 25 3 213 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
A0A0H3JXA3 1.93e-15 75 26 7 221 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q88UV2 2e-15 76 27 3 199 3 metN2 Methionine import ATP-binding protein MetN 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q87AL9 2.11e-15 76 28 6 200 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q631Y4 2.31e-15 76 27 6 202 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ZK / E33L)
Q81XL3 2.38e-15 76 27 6 202 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus anthracis
Q47YG8 3.2e-15 75 27 5 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5LUR8 3.48e-15 75 27 4 204 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A1JRI2 3.51e-15 74 29 4 205 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q3A558 3.81e-15 74 28 5 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3BNZ3 4.02e-15 75 26 3 203 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q04DA7 4.41e-15 75 26 4 194 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q02R79 5.07e-15 75 29 6 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9HY19 5.48e-15 75 29 6 216 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZCM4 5.73e-15 73 27 4 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rickettsia prowazekii (strain Madrid E)
Q46Y69 5.8e-15 75 27 3 200 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8UFV7 5.99e-15 73 28 4 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Agrobacterium fabrum (strain C58 / ATCC 33970)
Q63H29 7.22e-15 75 27 4 191 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q81VM2 7.44e-15 75 27 4 191 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q6D3Q6 7.8e-15 75 26 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P21410 9.27e-15 74 31 7 185 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Serratia marcescens
Q81IZ6 9.61e-15 74 26 4 191 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6MMY0 1.02e-14 73 29 4 179 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q928L8 1.11e-14 74 26 5 209 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q831K6 1.12e-14 74 27 7 226 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
P27675 1.18e-14 73 24 6 220 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q83CV2 1.31e-14 72 28 7 220 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P75370 1.32e-14 73 24 3 220 3 p29 Probable ABC transporter ATP-binding protein p29 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q71X09 1.35e-14 74 25 5 209 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
Q48PU6 1.45e-14 73 24 3 208 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5WDP1 1.47e-14 74 26 4 198 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q6D4A8 1.58e-14 73 27 3 202 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q4UMZ7 1.59e-14 72 26 4 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O34814 1.66e-14 72 25 5 208 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
P44692 1.8e-14 73 27 5 205 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q98G43 1.85e-14 73 27 4 180 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9A502 1.9e-14 73 22 4 209 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A3CVD3 2.05e-14 73 26 5 199 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
P45095 2.08e-14 73 29 5 224 3 dppD Dipeptide transport ATP-binding protein DppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3KCC5 2.12e-14 73 25 3 199 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
Q4ZZR8 2.18e-14 73 25 5 211 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q5X627 2.34e-14 73 27 5 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q87R20 2.43e-14 72 26 3 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8Y4L8 2.45e-14 73 25 5 209 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q3B276 2.46e-14 72 25 3 195 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q63GR8 2.49e-14 73 26 4 211 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q8ENU2 2.51e-14 73 24 3 204 3 metN2 Methionine import ATP-binding protein MetN 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q88XV2 2.57e-14 72 28 3 185 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q74IV9 2.59e-14 73 26 3 218 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q73F11 2.65e-14 73 26 4 196 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q13VD7 2.75e-14 73 26 4 204 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q0SZJ4 2.84e-14 72 27 4 208 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri serotype 5b (strain 8401)
Q03PF2 3.01e-14 73 26 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q83J78 3.08e-14 72 27 4 208 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri
Q1IKM7 3.22e-14 71 28 3 189 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Koribacter versatilis (strain Ellin345)
Q8Y0X3 3.52e-14 73 26 5 202 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q3KK97 3.56e-14 73 25 5 211 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
Q6HPM9 3.6e-14 72 28 4 200 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 3.6e-14 72 28 4 200 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
Q24QI5 3.6e-14 73 26 3 201 3 metN Methionine import ATP-binding protein MetN Desulfitobacterium hafniense (strain Y51)
Q92GP5 3.61e-14 71 26 4 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q12NL5 3.63e-14 71 25 4 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q604C1 3.7e-14 71 26 3 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A0R8K9 3.82e-14 72 28 4 200 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q1IGZ0 4.09e-14 72 25 4 200 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q57213 5e-14 70 33 6 181 3 HI_1474 Uncharacterized ABC transporter ATP-binding protein HI_1474 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8FCN0 5.78e-14 71 27 4 208 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9KS33 5.89e-14 72 28 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1R5D9 5.95e-14 71 27 4 208 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain UTI89 / UPEC)
Q0TBX9 5.95e-14 71 27 4 208 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q49W48 6.16e-14 72 25 4 201 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P33593 7e-14 71 27 4 208 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain K12)
Q31I51 7.5e-14 71 23 4 217 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2P7S3 7.52e-14 72 26 3 203 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q0I3C2 7.84e-14 70 25 3 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Histophilus somni (strain 129Pt)
Q6HP89 8.09e-14 72 25 4 211 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q5H503 8.3e-14 72 26 3 203 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q81ZF5 8.33e-14 72 25 4 211 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q8X5U1 8.49e-14 71 27 4 208 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O157:H7
Q043Y8 8.54e-14 72 25 3 220 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q1RK34 9.35e-14 70 25 4 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rickettsia bellii (strain RML369-C)
Q3IL62 9.43e-14 70 27 4 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudoalteromonas translucida (strain TAC 125)
Q65F80 9.76e-14 72 26 4 198 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q88RL5 9.81e-14 71 25 5 200 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q39EV3 1e-13 70 26 3 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5M1F6 1.04e-13 72 28 5 198 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q9HT70 1.06e-13 71 25 4 199 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 1.06e-13 71 25 4 199 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1BHS6 1.1e-13 70 26 3 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia orbicola (strain AU 1054)
Q6ME20 1.18e-13 71 27 4 200 3 metN Methionine import ATP-binding protein MetN Protochlamydia amoebophila (strain UWE25)
Q1LQF6 1.18e-13 71 25 3 199 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q73EL7 1.21e-13 71 25 3 198 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q66AT7 1.23e-13 70 28 6 209 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
P54537 1.24e-13 70 25 5 217 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q134N9 1.25e-13 71 27 5 207 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB5)
Q2GJA5 1.29e-13 70 22 5 223 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma phagocytophilum (strain HZ)
Q1CJG3 1.32e-13 70 28 6 209 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIC2 1.32e-13 70 28 6 209 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q1C812 1.32e-13 70 28 6 209 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q5M5Z2 1.33e-13 71 28 5 198 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5HQQ9 1.34e-13 71 25 4 197 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9K789 1.34e-13 71 25 4 197 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6G3A6 1.34e-13 70 26 3 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q8Y0C6 1.35e-13 70 28 3 172 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0BMC9 1.36e-13 71 24 3 212 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 1.36e-13 71 24 3 212 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q8CTB2 1.38e-13 71 25 4 197 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5L222 1.46e-13 71 25 5 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q87UN4 1.48e-13 71 24 5 211 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q52666 1.49e-13 70 25 6 203 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q81IN8 1.54e-13 71 25 3 198 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
O32169 1.61e-13 71 25 3 199 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q31GF5 1.62e-13 70 27 4 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P50980 1.65e-13 71 25 7 222 3 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. cremoris (strain SK11)
Q8ZRV2 1.65e-13 70 28 5 206 1 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q81GC1 1.68e-13 71 27 5 196 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5NFU5 1.68e-13 71 24 3 212 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
P0AAF9 1.71e-13 70 29 5 206 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF6 1.71e-13 70 29 5 206 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF7 1.71e-13 70 29 5 206 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF8 1.71e-13 70 29 5 206 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
Q5ZWE4 1.74e-13 71 26 4 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q3YW49 1.92e-13 70 27 5 209 3 nikD Nickel import ATP-binding protein NikD Shigella sonnei (strain Ss046)
Q8E3S0 1.97e-13 71 26 4 202 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q12B04 2.05e-13 70 25 3 199 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q87EF4 2.1e-13 69 26 5 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xylella fastidiosa (strain Temecula1 / ATCC 700964)
O34677 2.2e-13 69 24 5 216 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q31VE7 2.24e-13 70 27 5 209 3 nikD Nickel import ATP-binding protein NikD Shigella boydii serotype 4 (strain Sb227)
Q14H97 2.26e-13 70 24 3 212 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q7VMV4 2.3e-13 69 25 4 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q56927 2.34e-13 70 29 6 179 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia enterocolitica
P57066 2.42e-13 69 26 3 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DY54 2.46e-13 70 26 4 202 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 2.46e-13 70 26 4 202 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5HIL5 2.6e-13 70 23 2 198 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 2.6e-13 70 23 2 198 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 2.6e-13 70 23 2 198 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q89KN0 2.97e-13 69 26 4 204 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q63E84 3.04e-13 70 27 5 196 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 3.04e-13 70 27 5 196 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 3.04e-13 70 27 5 196 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q93DA2 3.05e-13 70 29 6 198 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q1DDP4 3.09e-13 70 29 6 209 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q6HLQ9 3.1e-13 70 27 5 196 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q5LI72 3.11e-13 68 27 4 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64Z80 3.14e-13 68 27 4 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain YCH46)
P0A2V5 3.38e-13 70 23 3 201 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 3.38e-13 70 23 3 201 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
Q6N798 3.4e-13 70 26 6 207 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q32AQ2 3.49e-13 69 26 4 208 3 nikD Nickel import ATP-binding protein NikD Shigella dysenteriae serotype 1 (strain Sd197)
Q5WXF0 3.5e-13 70 28 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
P45171 3.65e-13 70 27 7 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4K681 4.05e-13 70 26 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6KHL1 4.16e-13 69 26 7 204 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
P76027 4.23e-13 70 28 5 203 1 oppD Oligopeptide transport ATP-binding protein OppD Escherichia coli (strain K12)
Q81TH8 4.41e-13 69 27 5 196 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
Q07733 4.51e-13 70 25 7 222 1 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. lactis (strain IL1403)
Q57TF5 4.66e-13 68 28 5 206 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella choleraesuis (strain SC-B67)
P45289 4.73e-13 69 27 3 200 3 sapF Peptide transport system ATP-binding protein SapF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5PDF8 4.9e-13 68 28 5 206 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q2YVT7 4.9e-13 69 23 2 197 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A7E3 5e-13 69 23 2 198 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 5e-13 69 23 2 198 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6G2E2 5.12e-13 69 27 7 204 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5JEB0 5.14e-13 69 35 6 165 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q4QK57 5.21e-13 70 27 7 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
O85818 5.21e-13 70 27 7 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
P0AAG2 5.31e-13 69 28 5 225 3 dppD Dipeptide transport ATP-binding protein DppD Shigella flexneri
P0AAG0 5.31e-13 69 28 5 225 1 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli (strain K12)
P0AAG1 5.31e-13 69 28 5 225 3 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli O157:H7
Q6FZX3 5.47e-13 68 27 4 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bartonella quintana (strain Toulouse)
Q92EZ6 5.64e-13 69 22 3 196 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q17VE0 5.91e-13 69 27 6 198 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q0BN75 6.23e-13 68 26 5 204 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain OSU18)
Q4KKK8 6.37e-13 69 24 6 211 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6GJL2 7.67e-13 69 23 2 198 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q1GFI8 7.84e-13 68 28 3 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ruegeria sp. (strain TM1040)
Q1J8E4 8.22e-13 69 28 5 198 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q97T09 8.26e-13 69 26 4 193 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q1CFH7 8.29e-13 69 25 2 199 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 8.29e-13 69 25 2 199 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 8.29e-13 69 25 2 199 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q44613 8.65e-13 67 28 3 185 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q65UE1 8.73e-13 69 28 7 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P04285 9.31e-13 68 27 6 204 1 oppD Oligopeptide transport ATP-binding protein OppD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q89LP2 9.83e-13 68 22 3 207 3 metN Methionine import ATP-binding protein MetN Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2SXD1 1.01e-12 68 28 3 176 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q3J1N0 1.01e-12 68 25 4 202 3 metN Methionine import ATP-binding protein MetN Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q63SP4 1.04e-12 68 28 3 176 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia pseudomallei (strain K96243)
Q62J04 1.04e-12 68 28 3 176 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia mallei (strain ATCC 23344)
Q5XDS8 1.07e-12 68 28 5 198 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8DRF9 1.08e-12 68 26 4 197 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q48V78 1.09e-12 68 28 5 198 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 1.09e-12 68 28 5 198 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
P57032 1.09e-12 67 26 5 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xylella fastidiosa (strain 9a5c)
Q88HL1 1.13e-12 68 26 5 219 3 nikD Nickel import ATP-binding protein NikD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q58488 1.16e-12 68 28 7 207 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q667L9 1.28e-12 68 25 2 199 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
G7CBF6 1.36e-12 68 26 7 221 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316)
Q1WVG9 1.38e-12 68 26 8 224 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
P26905 1.47e-12 68 28 5 200 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
Q0A8P9 1.5e-12 67 26 4 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q4L4R9 1.52e-12 68 24 4 201 3 metN Methionine import ATP-binding protein MetN Staphylococcus haemolyticus (strain JCSC1435)
Q3B2U2 1.52e-12 67 27 3 190 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q6D645 1.64e-12 67 27 4 216 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q65TB7 1.65e-12 67 25 4 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q3IWB5 1.66e-12 67 26 4 205 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q110U3 1.69e-12 68 26 5 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q5NHP2 1.72e-12 67 26 5 204 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q2A4V5 1.72e-12 67 26 5 204 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain LVS)
Q14J44 1.72e-12 67 26 5 204 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. tularensis (strain FSC 198)
Q6WB63 1.73e-12 67 26 3 196 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
Q1QVQ7 1.73e-12 68 27 4 180 3 metN Methionine import ATP-binding protein MetN Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9I1C8 1.74e-12 68 26 5 207 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WQK1 1.82e-12 67 28 4 190 1 Rv0986 Uncharacterized ABC transporter ATP-binding protein Rv0986 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQK0 1.82e-12 67 28 4 190 3 MT1014 Uncharacterized ABC transporter ATP-binding protein MT1014 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8NY21 1.86e-12 68 23 2 198 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 1.86e-12 68 23 2 198 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
P94411 1.89e-12 67 26 7 211 3 yclH Uncharacterized ABC transporter ATP-binding protein YclH Bacillus subtilis (strain 168)
Q8RCU0 1.92e-12 67 26 4 188 3 pstB1 Phosphate import ATP-binding protein PstB 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q473H8 1.98e-12 67 27 3 175 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2K9R2 1.99e-12 67 28 4 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1MIJ4 2.03e-12 67 27 4 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9CP06 2.04e-12 68 27 7 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q8R7Y5 2.04e-12 67 27 4 201 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q73R11 2.07e-12 68 26 5 209 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q7A6M2 2.26e-12 67 24 4 197 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain N315)
Q99VG8 2.26e-12 67 24 4 197 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8Z9I6 2.33e-12 67 27 5 206 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhi
Q02ME3 2.33e-12 68 26 5 207 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1BY14 2.38e-12 67 25 4 203 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 2.38e-12 67 25 4 203 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q57554 2.4e-12 67 24 3 205 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8G5P8 2.53e-12 68 22 4 200 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
P26050 2.54e-12 67 31 6 183 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
D4GP38 2.54e-12 68 25 4 217 1 xacJ Xylose/arabinose import ATP-binding protein XacJ Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q8YA75 2.63e-12 67 22 3 196 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q7VM95 2.78e-12 67 24 5 215 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A0ALT6 2.99e-12 67 28 6 188 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q6GIH9 2.99e-12 67 25 4 197 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MRSA252)
Q830W6 3.09e-12 67 23 2 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q81C68 3.14e-12 66 25 6 199 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q668Q3 3.19e-12 67 27 6 199 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q9I6T2 3.24e-12 67 25 4 204 3 potA1 Spermidine/putrescine import ATP-binding protein PotA 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5WBL0 3.26e-12 66 29 6 193 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q6NJ07 3.32e-12 67 23 3 200 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q1CJS9 3.38e-12 67 27 6 199 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCM2 3.38e-12 67 27 6 199 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis
Q1C607 3.38e-12 67 27 6 199 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Antiqua)
Q1JII9 3.48e-12 67 28 5 198 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7N8M2 3.56e-12 67 25 2 192 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P24136 3.63e-12 67 28 6 200 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)
A1VZQ5 3.99e-12 66 23 5 217 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q87RE5 4.06e-12 66 26 4 203 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7ULB5 4.21e-12 67 28 4 183 3 macB Macrolide export ATP-binding/permease protein MacB Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P0A9U0 4.23e-12 66 30 4 171 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Shigella flexneri
P0A9T8 4.23e-12 66 30 4 171 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli (strain K12)
P0A9T9 4.23e-12 66 30 4 171 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli O157:H7
Q5X484 4.33e-12 67 24 6 208 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q5E715 4.47e-12 67 24 3 193 3 metN Methionine import ATP-binding protein MetN Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q2YWP2 4.59e-12 67 24 4 197 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
P45052 4.82e-12 67 27 5 201 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VP69 5.06e-12 65 26 5 193 3 thiQ Thiamine import ATP-binding protein ThiQ Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8NXH5 5.15e-12 67 24 4 197 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MW2)
Q6GB18 5.15e-12 67 24 4 197 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MSSA476)
Q5HHK4 5.15e-12 67 24 4 197 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain COL)
Q2FZZ2 5.15e-12 67 24 4 197 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FII2 5.15e-12 67 24 4 197 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain USA300)
Q6LR20 5.22e-12 67 24 3 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
P56344 5.23e-12 65 28 2 192 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q0I4A9 5.26e-12 66 26 5 209 3 znuC Zinc import ATP-binding protein ZnuC Histophilus somni (strain 129Pt)
Q3KKA1 5.31e-12 66 24 3 203 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q7VI92 5.47e-12 67 25 4 206 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q2IYS5 5.61e-12 66 26 2 205 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q71WH8 5.75e-12 66 28 6 188 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q5M243 5.75e-12 66 27 4 185 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ3 5.75e-12 66 27 4 185 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain CNRZ 1066)
Q927N9 5.92e-12 66 28 6 188 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q97KD5 5.94e-12 66 23 3 213 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P47326 6.13e-12 67 34 0 96 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q1RGL1 6.35e-12 65 24 5 209 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia bellii (strain RML369-C)
Q5WVL8 6.38e-12 66 24 6 211 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
P0A9W5 6.39e-12 67 26 5 210 3 ettA Energy-dependent translational throttle protein EttA Shigella flexneri
P0A9W5 2.25e-06 50 25 7 224 3 ettA Energy-dependent translational throttle protein EttA Shigella flexneri
P0A9W3 6.39e-12 67 26 5 210 1 ettA Energy-dependent translational throttle protein EttA Escherichia coli (strain K12)
P0A9W3 2.25e-06 50 25 7 224 1 ettA Energy-dependent translational throttle protein EttA Escherichia coli (strain K12)
P0A9W4 6.39e-12 67 26 5 210 3 ettA Energy-dependent translational throttle protein EttA Escherichia coli O157:H7
P0A9W4 2.25e-06 50 25 7 224 3 ettA Energy-dependent translational throttle protein EttA Escherichia coli O157:H7
Q1LPJ9 6.52e-12 65 28 3 175 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0P9X7 6.59e-12 65 23 5 217 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8Y455 6.79e-12 66 28 6 188 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q97JB8 6.98e-12 66 24 4 199 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q38UT9 7.32e-12 66 26 6 210 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q0I3Y9 7.38e-12 66 25 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
P37774 7.58e-12 65 25 6 229 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q5ZUG5 7.82e-12 66 24 6 211 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q7MKU3 8.24e-12 66 25 4 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 8.24e-12 66 25 4 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
P23703 8.25e-12 66 29 6 203 3 nodI Nod factor export ATP-binding protein I Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q98QH5 8.56e-12 65 29 6 186 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8KF76 8.66e-12 65 26 7 199 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9LV93 8.68e-12 66 27 5 185 2 ABCF5 ABC transporter F family member 5 Arabidopsis thaliana
Q6D1C4 8.77e-12 66 24 3 210 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3M5J9 8.83e-12 65 26 5 193 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q1IGN4 8.96e-12 66 22 4 209 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas entomophila (strain L48)
Q65UG3 9e-12 65 23 3 204 3 znuC Zinc import ATP-binding protein ZnuC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8PC11 9.11e-12 66 26 6 211 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q1D382 9.2e-12 65 25 3 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Myxococcus xanthus (strain DK1622)
Q8GEH7 9.4e-12 66 26 6 197 3 metN Methionine import ATP-binding protein MetN Erwinia pyrifoliae (strain DSM 12162 / Ep1/96)
Q03I82 9.53e-12 65 27 4 185 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q21PQ7 9.75e-12 65 25 6 212 3 znuC Zinc import ATP-binding protein ZnuC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q88ZJ6 9.94e-12 66 24 2 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8ZR89 1.03e-11 66 24 2 198 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q49ZT6 1.05e-11 64 27 3 193 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6FFL0 1.06e-11 65 23 5 205 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q65M34 1.11e-11 65 23 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P07821 1.19e-11 65 31 7 202 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
Q63H61 1.2e-11 65 25 3 199 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ZK / E33L)
Q895C4 1.27e-11 65 21 4 214 3 metN Methionine import ATP-binding protein MetN Clostridium tetani (strain Massachusetts / E88)
Q8ELR4 1.31e-11 65 26 6 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P75551 1.32e-11 66 34 0 96 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q88RB3 1.41e-11 65 25 6 204 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2RU16 1.43e-11 64 27 5 196 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q7UX73 1.51e-11 64 26 3 203 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q18C09 1.56e-11 65 24 4 204 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q57S53 1.6e-11 65 24 2 198 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q4QMH4 1.67e-11 65 24 3 198 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q7NTU0 1.76e-11 64 29 7 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q82VL9 1.96e-11 64 25 4 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P42064 2e-11 65 24 3 200 3 appD Oligopeptide transport ATP-binding protein AppD Bacillus subtilis (strain 168)
O26096 2.11e-11 65 25 5 208 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
P44531 2.12e-11 65 23 2 213 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O52618 2.13e-11 65 31 6 182 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
Q1BR30 2.15e-11 65 25 8 223 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 2.15e-11 65 25 8 223 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
Q0I2Z4 2.2e-11 65 23 2 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
Q1GMA8 2.3e-11 64 26 5 216 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Ruegeria sp. (strain TM1040)
Q9CM80 2.31e-11 65 24 2 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
Q2NTI7 2.32e-11 64 26 5 204 3 znuC Zinc import ATP-binding protein ZnuC Sodalis glossinidius (strain morsitans)
Q1Q889 2.38e-11 64 27 6 209 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q0C1C3 2.4e-11 63 28 5 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hyphomonas neptunium (strain ATCC 15444)
Q48PV0 2.4e-11 64 25 6 204 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q7A3X3 2.4e-11 63 27 4 198 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain N315)
Q99RR8 2.4e-11 63 27 4 198 2 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q9X196 2.42e-11 65 25 6 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7VLS9 2.43e-11 64 27 3 202 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4KKK4 2.46e-11 64 23 4 205 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1CR30 2.49e-11 65 25 6 208 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q13LD8 2.58e-11 65 26 7 202 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q8NV47 2.6e-11 63 27 4 198 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain MW2)
Q6G6W1 2.6e-11 63 27 4 198 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain MSSA476)
A6QJK1 2.6e-11 63 27 4 198 2 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain Newman)
Q5HDJ6 2.6e-11 63 27 4 198 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain COL)
Q2YZ26 2.6e-11 63 27 4 197 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FVR1 2.6e-11 63 27 4 198 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED7 2.6e-11 63 27 4 198 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain USA300)
Q8FV85 2.65e-11 65 24 4 199 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 2.65e-11 65 24 4 199 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 2.65e-11 65 24 4 199 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12420
Feature type CDS
Gene -
Product ATP-binding cassette domain-containing protein
Location 2754905 - 2755516 (strand: -1)
Length 612 (nucleotides) / 203 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2354
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1124 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component

Protein Sequence

MPLLALQQLSVQQAGKMLWHDLSFSLEAGERLGISAPSGRGKTTLGRVLAQWQMPTSGQILFNQQPLPKKGYCPIQLVPQHPDKCFNPFRTTGESVRDAWVPDSLWLEKLMIEPEWLTRRPNELSGGELARIALLRALDPRTQLLIADEVTAQLDAQIQAKIWQVLIDESQKRPLSLIIFSHNKALLEKVSTRIWWVDKEKIC

Flanking regions ( +/- flanking 50bp)

TCTTTATATACCTTTTTCTCTTAGAGAACCCTATTTTTGAGGTTATTTTTATGCCACTTTTAGCGCTACAACAACTCTCTGTGCAACAAGCCGGTAAGATGTTATGGCATGATCTCTCTTTTTCATTAGAGGCGGGAGAGCGCTTAGGCATTTCTGCGCCAAGTGGTAGAGGAAAAACAACGTTAGGTCGTGTATTAGCACAATGGCAAATGCCGACTAGTGGGCAAATTCTTTTTAATCAGCAACCTCTGCCTAAGAAAGGTTATTGTCCCATTCAATTGGTTCCGCAACATCCTGATAAATGTTTTAATCCATTTAGAACAACCGGAGAGAGTGTACGTGATGCATGGGTGCCTGATAGCCTGTGGCTTGAAAAATTGATGATAGAGCCAGAGTGGTTAACCCGTAGGCCTAATGAGTTATCAGGAGGAGAATTGGCACGTATTGCATTACTACGAGCACTTGATCCTCGAACACAATTATTAATTGCAGATGAAGTGACTGCACAATTAGATGCACAGATCCAAGCCAAAATTTGGCAAGTATTAATCGATGAAAGTCAAAAACGTCCTTTAAGTTTAATTATCTTTAGTCACAATAAAGCCTTACTAGAAAAAGTATCTACCAGAATATGGTGGGTAGATAAGGAAAAAATATGTTGATAGTAAAAAGGATACTAGAGCGATTTTAATAAAAAAAAGCTTCCTGTATT