Homologs in group_2317

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17800 FBDBKF_17800 59.5 Morganella morganii S1 rimI ribosomal protein S18-alanine N-acetyltransferase
EHELCC_09825 EHELCC_09825 59.5 Morganella morganii S2 rimI ribosomal protein S18-alanine N-acetyltransferase
NLDBIP_10205 NLDBIP_10205 59.5 Morganella morganii S4 rimI ribosomal protein S18-alanine N-acetyltransferase
LHKJJB_07550 LHKJJB_07550 59.5 Morganella morganii S3 rimI ribosomal protein S18-alanine N-acetyltransferase
HKOGLL_07100 HKOGLL_07100 59.5 Morganella morganii S5 rimI ribosomal protein S18-alanine N-acetyltransferase
F4V73_RS15165 F4V73_RS15165 57.4 Morganella psychrotolerans rimI ribosomal protein S18-alanine N-acetyltransferase

Distribution of the homologs in the orthogroup group_2317

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2317

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZJW4 7.84e-66 199 60 0 148 1 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A947 3.71e-64 195 59 0 148 3 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Shigella flexneri
P0A944 3.71e-64 195 59 0 148 1 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Escherichia coli (strain K12)
P0A945 3.71e-64 195 59 0 148 3 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A946 3.71e-64 195 59 0 148 1 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Escherichia coli O157:H7
P44305 2.93e-48 155 54 2 144 3 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VP85 3e-44 145 50 1 134 3 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
O05517 8.29e-21 85 36 5 149 3 rimI Putative [ribosomal protein bS18]-alanine N-acetyltransferase Bacillus subtilis (strain 168)
Q49857 1.63e-12 66 34 8 148 3 ML0378 Uncharacterized protein ML0378 Mycobacterium leprae (strain TN)
I6YG32 3.84e-12 63 33 7 137 1 rimI N-alpha-acetyltransferase RimI Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
D2Q187 2.74e-08 54 29 5 124 3 mshD Mycothiol acetyltransferase Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399)
A9WNI5 1.05e-07 53 32 3 113 3 mshD Mycothiol acetyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q6B949 5.64e-07 50 29 4 120 3 ycf52 Uncharacterized N-acetyltransferase ycf52 Gracilaria tenuistipitata var. liui
Q976C3 7.58e-07 49 35 4 98 3 STK_02580 N-alpha-acetyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
D1A4F4 8.85e-07 50 27 2 108 3 mshD Mycothiol acetyltransferase Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)
P08457 1.09e-06 49 28 2 107 1 sta Streptothricin acetyltransferase Streptomyces lavendulae
D7GG24 6.08e-06 47 27 1 92 3 mshD Mycothiol acetyltransferase Propionibacterium freudenreichii subsp. shermanii (strain ATCC 9614 / DSM 4902 / CIP 103027 / NCIMB 8099 / CIRM-BIA1)
Q980R9 6.23e-06 47 30 4 114 1 ard1 N-alpha-acetyltransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
C7M077 2.35e-05 46 28 2 103 3 mshD Mycothiol acetyltransferase Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP)
P76112 6.6e-05 44 35 0 53 1 mnaT L-amino acid N-acyltransferase MnaT Escherichia coli (strain K12)
Q9KZV0 0.000106 44 33 1 75 2 mshD Mycothiol acetyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C5C246 0.000127 43 32 1 70 3 mshD Mycothiol acetyltransferase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
D2B7W7 0.000175 43 29 1 84 3 mshD Mycothiol acetyltransferase Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / KCTC 9067 / NCIMB 10171 / NRRL 2505 / NI 9100)
Q1XDU5 0.000256 42 33 1 57 3 ycf52 Uncharacterized N-acetyltransferase ycf52 Neopyropia yezoensis
Q5KQI6 0.000277 42 32 1 59 1 SNAT1 Serotonin N-acetyltransferase 1, chloroplastic Oryza sativa subsp. japonica
A2Y5T7 0.000277 42 32 1 59 3 SNAT1 Serotonin N-acetyltransferase 1, chloroplastic Oryza sativa subsp. indica
P51192 0.000377 42 33 1 57 3 ycf52 Uncharacterized N-acetyltransferase ycf52 Porphyra purpurea
Q47LA0 0.000393 42 30 1 80 3 mshD Mycothiol acetyltransferase Thermobifida fusca (strain YX)
Q7X9V3 0.000517 42 30 1 59 1 NSI GCN5-related N-acetyltransferase 2, chloroplastic Arabidopsis thaliana
D6Y4C5 0.000531 42 31 0 60 3 mshD Mycothiol acetyltransferase Thermobispora bispora (strain ATCC 19993 / DSM 43833 / CBS 139.67 / JCM 10125 / KCTC 9307 / NBRC 14880 / R51)
Q8ZPD3 0.000838 41 33 0 54 1 yncA L-methionine sulfoximine/L-methionine sulfone acetyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q82G40 0.00087 41 29 1 77 3 mshD Mycothiol acetyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
K7MTW9 0.001 41 32 1 59 1 TAP1 Histone acetyltransferase TAP1 Glycine max

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12325
Feature type CDS
Gene rimI
Product ribosomal protein S18-alanine N-acetyltransferase
Location 2732932 - 2733378 (strand: -1)
Length 447 (nucleotides) / 148 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2317
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00583 Acetyltransferase (GNAT) family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0456 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S18 acetylase RimI and related acetyltransferases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03789 [ribosomal protein S18]-alanine N-acetyltransferase [EC:2.3.1.266] - -

Protein Sequence

MKTISPLNPADLPLAWEIEKLSHSFPWSEETFYSNQGDHYFNLKICIDNIMVGFAITQLILDEATLFNIAIHPDYQGKGYGKALLLELIDNIERKDIATLWLEVRESNQKASNLYESIGFNSVSVRKNYYPTATGKEDAIIMAYPIKF

Flanking regions ( +/- flanking 50bp)

ATATTTTGATGCCAATGCAAAACGCGATCTTTGGAAACAAATCTATCAACATGAAGACCATTTCCCCATTAAACCCTGCTGATTTACCTTTAGCATGGGAAATTGAAAAACTAAGTCATTCATTCCCTTGGAGCGAAGAAACATTCTATAGTAACCAAGGTGATCATTATTTTAATCTAAAAATTTGCATTGATAATATTATGGTAGGTTTTGCTATTACGCAATTAATATTAGATGAAGCAACGCTTTTTAATATCGCGATACATCCTGATTATCAAGGTAAAGGCTATGGAAAAGCATTGTTATTAGAACTTATTGATAATATTGAAAGAAAAGATATTGCTACATTATGGCTTGAGGTAAGAGAATCCAATCAAAAAGCATCTAATCTCTATGAATCTATAGGATTTAATTCAGTATCTGTACGTAAGAATTATTATCCAACAGCAACGGGAAAAGAAGATGCGATAATCATGGCTTATCCAATTAAATTCTAATTAAATACTTATTTAAGTTAAATTAAAGACGTCTTCTATTAGGCGTCTTT