Homologs in group_2317

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17800 FBDBKF_17800 100.0 Morganella morganii S1 rimI ribosomal protein S18-alanine N-acetyltransferase
EHELCC_09825 EHELCC_09825 100.0 Morganella morganii S2 rimI ribosomal protein S18-alanine N-acetyltransferase
LHKJJB_07550 LHKJJB_07550 100.0 Morganella morganii S3 rimI ribosomal protein S18-alanine N-acetyltransferase
HKOGLL_07100 HKOGLL_07100 100.0 Morganella morganii S5 rimI ribosomal protein S18-alanine N-acetyltransferase
F4V73_RS15165 F4V73_RS15165 86.0 Morganella psychrotolerans rimI ribosomal protein S18-alanine N-acetyltransferase
PMI_RS12325 PMI_RS12325 59.5 Proteus mirabilis HI4320 rimI ribosomal protein S18-alanine N-acetyltransferase

Distribution of the homologs in the orthogroup group_2317

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2317

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZJW4 1.65e-65 199 64 0 148 1 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A947 7.72e-65 197 62 0 148 3 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Shigella flexneri
P0A944 7.72e-65 197 62 0 148 1 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Escherichia coli (strain K12)
P0A945 7.72e-65 197 62 0 148 3 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A946 7.72e-65 197 62 0 148 1 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Escherichia coli O157:H7
P44305 9.08e-53 167 57 2 147 3 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VP85 7.34e-52 164 54 1 144 3 rimI [Ribosomal protein bS18]-alanine N-acetyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
O05517 2.42e-21 87 37 2 134 3 rimI Putative [ribosomal protein bS18]-alanine N-acetyltransferase Bacillus subtilis (strain 168)
I6YG32 2.03e-13 66 36 4 110 1 rimI N-alpha-acetyltransferase RimI Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q49857 5.1e-12 65 32 5 148 3 ML0378 Uncharacterized protein ML0378 Mycobacterium leprae (strain TN)
P08457 3.91e-11 61 36 3 108 1 sta Streptothricin acetyltransferase Streptomyces lavendulae
Q976C3 3.7e-10 58 36 4 111 3 STK_02580 N-alpha-acetyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q980R9 6.03e-09 55 43 3 86 1 ard1 N-alpha-acetyltransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
D1A4F4 1.47e-07 52 32 2 108 3 mshD Mycothiol acetyltransferase Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)
B2GI63 1.97e-07 52 43 0 64 3 mshD Mycothiol acetyltransferase Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
D2Q187 2.47e-07 52 35 1 85 3 mshD Mycothiol acetyltransferase Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399)
Q4JBG0 5.51e-07 49 30 8 159 3 Saci_0459 N-alpha-acetyltransferase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9KL03 1.39e-06 48 38 1 57 1 speG Spermidine N(1)-acetyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A9WNI5 1.48e-06 49 37 1 69 3 mshD Mycothiol acetyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
C5C246 1.54e-06 49 38 1 72 3 mshD Mycothiol acetyltransferase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q9KZV0 1.88e-06 49 36 1 77 2 mshD Mycothiol acetyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P16426 2.24e-06 48 31 1 88 1 bar Phosphinothricin N-acetyltransferase Streptomyces hygroscopicus
C5CC88 2.35e-06 49 36 1 82 3 mshD Mycothiol acetyltransferase Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
D5UXA4 3.6e-06 48 39 2 81 3 mshD Mycothiol acetyltransferase Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / CCUG 35730 / CIP 100753 / JCM 10117 / KCTC 9821 / NBRC 16120 / NCIMB 702349 / NCTC 13040)
D2B7W7 4.09e-06 48 34 1 90 3 mshD Mycothiol acetyltransferase Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / KCTC 9067 / NCIMB 10171 / NRRL 2505 / NI 9100)
D6Y4C5 5.17e-06 48 33 1 90 3 mshD Mycothiol acetyltransferase Thermobispora bispora (strain ATCC 19993 / DSM 43833 / CBS 139.67 / JCM 10125 / KCTC 9307 / NBRC 14880 / R51)
C7NK43 5.38e-06 48 33 2 87 3 mshD Mycothiol acetyltransferase Kytococcus sedentarius (strain ATCC 14392 / DSM 20547 / JCM 11482 / CCUG 33030 / NBRC 15357 / NCTC 11040 / CCM 314 / 541)
B1VS15 5.87e-06 48 34 1 78 3 mshD Mycothiol acetyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q82G40 6.86e-06 47 37 1 77 3 mshD Mycothiol acetyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q47LA0 7.35e-06 47 34 2 82 3 mshD Mycothiol acetyltransferase Thermobifida fusca (strain YX)
D7C376 8.8e-06 47 35 1 78 3 mshD Mycothiol acetyltransferase Streptomyces bingchenggensis (strain BCW-1)
C7QKH8 1.05e-05 47 28 1 95 3 mshD Mycothiol acetyltransferase Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908)
A1R8Y2 1.34e-05 47 32 1 95 3 mshD Mycothiol acetyltransferase Paenarthrobacter aurescens (strain TC1)
A0JZC2 1.77e-05 46 35 0 70 3 mshD Mycothiol acetyltransferase Arthrobacter sp. (strain FB24)
D2NRH2 1.8e-05 46 35 1 77 3 mshD Mycothiol acetyltransferase Rothia mucilaginosa (strain DY-18)
B8HD44 1.81e-05 46 34 0 70 3 mshD Mycothiol acetyltransferase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
D7AWZ7 2.27e-05 46 34 2 92 3 mshD Mycothiol acetyltransferase Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / CIP 107115 / JCM 7437 / KCTC 9190 / NBRC 14626 / NCTC 10488 / NRRL B-5397 / IMRU 509)
D7AWZ7 7.3e-05 44 35 5 94 3 mshD Mycothiol acetyltransferase Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / CIP 107115 / JCM 7437 / KCTC 9190 / NBRC 14626 / NCTC 10488 / NRRL B-5397 / IMRU 509)
D7GG24 2.74e-05 46 32 2 89 3 mshD Mycothiol acetyltransferase Propionibacterium freudenreichii subsp. shermanii (strain ATCC 9614 / DSM 4902 / CIP 103027 / NCIMB 8099 / CIRM-BIA1)
P76112 2.96e-05 45 35 0 53 1 mnaT L-amino acid N-acyltransferase MnaT Escherichia coli (strain K12)
Q8ZPD3 3.27e-05 45 37 0 54 1 yncA L-methionine sulfoximine/L-methionine sulfone acetyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6D8U7 3.43e-05 44 25 3 120 3 ECA0875 Acetyltransferase ECA0875 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A5CTZ8 4.65e-05 45 34 0 87 3 mshD Mycothiol acetyltransferase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
C7MRC4 4.88e-05 45 35 1 70 3 mshD Mycothiol acetyltransferase Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / CCUG 5913 / NBRC 12207 / NCIMB 9602 / P101)
A0LWI8 7.48e-05 44 33 2 92 3 mshD Mycothiol acetyltransferase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
P63423 9e-05 43 25 3 115 3 ypeA Acetyltransferase YpeA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63424 9e-05 43 25 3 115 3 ypeA Acetyltransferase YpeA Salmonella typhi
Q5PI26 9e-05 43 25 3 115 3 ypeA Acetyltransferase YpeA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57LQ8 9e-05 43 25 3 115 3 ypeA Acetyltransferase YpeA Salmonella choleraesuis (strain SC-B67)
C8XA55 0.000125 44 34 0 70 3 mshD Mycothiol acetyltransferase Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / CIP 104796 / JCM 9543 / NBRC 105858 / Y-104)
Q7X9V3 0.000125 43 35 1 57 1 NSI GCN5-related N-acetyltransferase 2, chloroplastic Arabidopsis thaliana
A4FQD4 0.000138 43 34 1 79 3 mshD Mycothiol acetyltransferase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q7PCJ8 0.000144 43 38 0 59 2 SAT2 Thialysine N-epsilon-acetyltransferase Bos taurus
Q3YZA9 0.000162 42 23 3 120 3 ypeA Acetyltransferase YpeA Shigella sonnei (strain Ss046)
P63422 0.000162 42 23 3 120 1 ypeA Acetyltransferase YpeA Shigella flexneri
Q0T275 0.000162 42 23 3 120 3 ypeA Acetyltransferase YpeA Shigella flexneri serotype 5b (strain 8401)
Q32DB9 0.000162 42 23 3 120 3 ypeA Acetyltransferase YpeA Shigella dysenteriae serotype 1 (strain Sd197)
Q1R8T7 0.000162 42 23 3 120 3 ypeA Acetyltransferase YpeA Escherichia coli (strain UTI89 / UPEC)
P63420 0.000162 42 23 3 120 3 ypeA Acetyltransferase YpeA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1ADU8 0.000162 42 23 3 120 3 ypeA Acetyltransferase YpeA Escherichia coli O1:K1 / APEC
P63421 0.000162 42 23 3 120 3 ypeA Acetyltransferase YpeA Escherichia coli O157:H7
B0RAV5 0.000169 43 33 0 90 3 mshD Mycothiol acetyltransferase Clavibacter sepedonicus
Q0TF35 0.000169 42 23 3 120 3 ypeA Acetyltransferase YpeA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
O34376 0.00017 43 35 0 59 3 yobR Uncharacterized N-acetyltransferase YobR Bacillus subtilis (strain 168)
Q7PCJ9 0.000174 43 37 0 59 2 SAT2 Thialysine N-epsilon-acetyltransferase Sus scrofa
Q5KQI6 0.00021 43 35 1 57 1 SNAT1 Serotonin N-acetyltransferase 1, chloroplastic Oryza sativa subsp. japonica
A2Y5T7 0.000217 43 35 1 57 3 SNAT1 Serotonin N-acetyltransferase 1, chloroplastic Oryza sativa subsp. indica
Q8ZCG0 0.000226 42 24 2 99 3 YPO3031 Uncharacterized N-acetyltransferase YPO3031/y1452/YP_2654 Yersinia pestis
Q668I7 0.000226 42 24 2 99 3 YPTB2753 Acetyltransferase YPTB2753 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1C5T8 0.000226 42 24 2 99 3 YPA_2219 Acetyltransferase YPA_2219 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TMK1 0.000226 42 24 2 99 3 YPDSF_2136 Acetyltransferase YPDSF_2136 Yersinia pestis (strain Pestoides F)
Q1CJZ6 0.000226 42 24 2 99 3 YPN_1354 Acetyltransferase YPN_1354 Yersinia pestis bv. Antiqua (strain Nepal516)
Q5YW78 0.000248 42 27 1 76 3 ectA L-2,4-diaminobutyric acid acetyltransferase Nocardia farcinica (strain IFM 10152)
Q31Y46 0.000269 42 23 3 115 3 ypeA Acetyltransferase YpeA Shigella boydii serotype 4 (strain Sb227)
Q8LGI8 0.000271 42 34 5 83 1 NAA20 N-terminal acetyltransferase B complex catalytic subunit NAA20 Arabidopsis thaliana
P13018 0.000282 42 34 1 75 3 sat-1 Streptothricin acetyltransferase Escherichia coli
Q9I1K2 0.000289 42 29 0 84 4 PA2271 Acetyltransferase PA2271 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B1VII5 0.000302 43 36 0 58 3 mshD Mycothiol acetyltransferase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q9QXS8 0.000337 42 31 0 60 2 Nat8f5 Probable N-acetyltransferase family 8 member 5 Mus musculus
P76539 0.000372 41 22 3 120 1 ypeA Acetyltransferase YpeA Escherichia coli (strain K12)
K7MTW9 0.000499 42 35 1 57 1 TAP1 Histone acetyltransferase TAP1 Glycine max
Q9C666 0.000527 42 35 1 57 1 SNAT2 GCN5-related N-acetyltransferase 1, chloroplastic Arabidopsis thaliana
C0ZP17 0.000579 42 32 0 64 3 mshD Mycothiol acetyltransferase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
C7MGB3 0.000661 42 36 1 65 3 mshD Mycothiol acetyltransferase Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / JCM 11609 / LMG 19847 / NBRC 14762 / NCIMB 9860 / 6-10)
C9ZFL1 0.000689 42 35 1 73 3 mshD Mycothiol acetyltransferase Streptomyces scabiei (strain 87.22)
A0A0R0IHP4 0.000708 42 35 1 57 1 TAP2 Probable acetyltransferase TAP2 Glycine max
Q96F10 0.000713 41 37 0 59 1 SAT2 Thialysine N-epsilon-acetyltransferase Homo sapiens
Q04751 0.000728 42 31 1 82 1 NAT4 N-alpha-acetyltransferase 40 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q58604 0.000757 41 38 2 68 3 MJ1207 Uncharacterized N-acetyltransferase MJ1207 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58925 0.000776 41 27 5 137 3 MJ1530 Uncharacterized N-acetyltransferase MJ1530 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10205
Feature type CDS
Gene rimI
Product ribosomal protein S18-alanine N-acetyltransferase
Location 202012 - 202467 (strand: -1)
Length 456 (nucleotides) / 151 (amino acids)

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2317
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00583 Acetyltransferase (GNAT) family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0456 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S18 acetylase RimI and related acetyltransferases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03789 [ribosomal protein S18]-alanine N-acetyltransferase [EC:2.3.1.266] - -

Protein Sequence

MIRLSPLLPADFAAAFRIEQAAHAYPWSEATFRSNHGERYHNLKLEADGELAGFAINQTVLDEATLFNIAVSPEHQGKGYGRQLLEKVIEDLTAKGIATLWLEVRASNSPAIALYESLGFNEVTVRKNYYPAAQGKEDAVIMALYLSFGMS

Flanking regions ( +/- flanking 50bp)

GTATCAGGATGCACAGGCAAAACGCGGATTATGGACACAAATTTATCATTATGATCAGACTGTCACCGCTGCTTCCCGCTGATTTTGCCGCCGCATTCCGTATTGAACAGGCCGCTCACGCTTATCCCTGGAGTGAAGCCACATTCCGCAGCAATCACGGCGAACGTTACCATAACCTGAAACTGGAAGCAGACGGGGAACTGGCCGGATTCGCCATCAACCAGACGGTACTGGATGAAGCGACCCTGTTTAATATTGCGGTTTCACCTGAGCATCAGGGAAAAGGTTATGGCCGTCAGTTACTGGAAAAAGTGATTGAAGACCTGACAGCAAAAGGGATTGCGACACTCTGGCTGGAAGTCCGGGCATCAAACAGCCCGGCGATTGCGCTGTATGAATCGCTTGGTTTTAATGAGGTCACTGTGCGGAAGAACTATTATCCGGCGGCACAGGGTAAAGAGGATGCAGTGATTATGGCGCTTTACCTGAGTTTCGGAATGTCATAGCGCGAAATGTAATAGAGCGATAAGTCAGATAAAACGGCGGTTTTTTATCC