Homologs in group_2996

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17335 FBDBKF_17335 50.4 Morganella morganii S1 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
EHELCC_01555 EHELCC_01555 50.4 Morganella morganii S2 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
NLDBIP_01905 NLDBIP_01905 50.4 Morganella morganii S4 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
LHKJJB_00130 LHKJJB_00130 50.4 Morganella morganii S3 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
HKOGLL_00170 HKOGLL_00170 50.4 Morganella morganii S5 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)

Distribution of the homologs in the orthogroup group_2996

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2996

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AG13 1.2e-51 163 56 1 139 3 umuD Protein UmuD Shigella flexneri
P0AG11 1.2e-51 163 56 1 139 1 umuD Protein UmuD Escherichia coli (strain K12)
P0AG12 1.2e-51 163 56 1 139 3 umuD Protein UmuD Escherichia coli O157:H7
P22493 1.51e-46 150 55 1 136 1 umuD Protein UmuD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23831 3.85e-42 139 55 1 124 3 samA Protein SamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A275 4e-39 132 48 2 141 3 mucA Protein MucA Salmonella typhimurium
P0A276 4e-39 132 48 2 141 3 mucA Protein MucA Escherichia coli
Q7BSM9 1.17e-37 128 54 1 124 3 impA Protein ImpA Shigella flexneri
P18641 1.17e-37 128 54 1 124 3 impA Protein ImpA Salmonella typhimurium
Q5J3U9 1.17e-37 128 54 1 124 3 impA Protein ImpA Salmonella choleraesuis (strain SC-B67)
Q7M1C0 1.17e-37 128 54 1 124 3 None Protein ImpA Escherichia coli
Q0VQU1 9.96e-18 79 41 4 119 3 lexA LexA repressor Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q881U0 3.27e-17 77 40 3 125 3 lexA2 LexA repressor 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3ACC4 3.5e-17 77 37 4 127 3 lexA LexA repressor Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A4XL42 6.56e-17 77 41 4 127 3 lexA LexA repressor Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B8CUX0 7.94e-17 76 39 4 127 3 lexA LexA repressor Shewanella piezotolerans (strain WP3 / JCM 13877)
A3Q951 1.31e-16 76 40 4 127 3 lexA LexA repressor Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q3SIT9 4.85e-16 74 34 5 150 3 lexA LexA repressor Thiobacillus denitrificans (strain ATCC 25259)
A2SGY5 5.38e-16 74 37 5 129 3 lexA LexA repressor Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A0LGS1 7.56e-16 73 37 4 126 3 lexA LexA repressor Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A8FPP0 7.8e-16 73 37 4 129 3 lexA LexA repressor Shewanella sediminis (strain HAW-EB3)
Q2SKC5 7.87e-16 73 38 3 118 3 lexA LexA repressor Hahella chejuensis (strain KCTC 2396)
Q8PBM1 1.16e-15 73 38 3 121 3 lexA1 LexA repressor 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A7HC61 1.77e-15 73 37 4 143 3 lexA LexA repressor Anaeromyxobacter sp. (strain Fw109-5)
B0TNT3 2.5e-15 72 38 4 127 3 lexA LexA repressor Shewanella halifaxensis (strain HAW-EB4)
Q8PN77 3.42e-15 72 37 3 121 3 lexA1 LexA repressor 1 Xanthomonas axonopodis pv. citri (strain 306)
A8H9S0 3.89e-15 72 38 4 127 3 lexA LexA repressor Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q87F45 5e-15 72 37 3 137 3 lexA LexA repressor Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I679 5e-15 72 37 3 137 3 lexA LexA repressor Xylella fastidiosa (strain M23)
Q5GX75 5.32e-15 71 37 4 127 3 lexA1 LexA repressor 1 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B4SRA9 5.39e-15 72 36 3 128 3 lexA LexA repressor Stenotrophomonas maltophilia (strain R551-3)
A3DDH9 6.18e-15 72 40 3 119 3 lexA LexA repressor Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A1SBC7 7.27e-15 71 38 3 119 3 lexA LexA repressor Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B0U1K7 7.37e-15 71 37 3 137 3 lexA LexA repressor Xylella fastidiosa (strain M12)
Q9PH24 7.93e-15 71 37 3 137 3 lexA LexA repressor Xylella fastidiosa (strain 9a5c)
Q47MY4 8.54e-15 72 40 4 125 3 lexA LexA repressor Thermobifida fusca (strain YX)
Q12ID6 9.33e-15 71 37 4 127 3 lexA LexA repressor Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A0LUZ1 1.05e-14 72 39 4 125 3 lexA LexA repressor Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A5GAQ4 1.38e-14 70 38 3 119 3 lexA LexA repressor Geotalea uraniireducens (strain Rf4)
A1A2G3 1.41e-14 71 40 4 125 3 lexA LexA repressor Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A0QVY5 1.83e-14 71 38 3 121 3 lexA LexA repressor Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A1K776 2.18e-14 70 36 4 130 3 lexA LexA repressor Azoarcus sp. (strain BH72)
Q129C4 2.3e-14 70 35 3 127 3 lexA LexA repressor Polaromonas sp. (strain JS666 / ATCC BAA-500)
B1KM68 2.44e-14 70 37 3 119 3 lexA LexA repressor Shewanella woodyi (strain ATCC 51908 / MS32)
A5CSL0 2.72e-14 70 40 3 119 3 lexA LexA repressor Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q1BA08 3.23e-14 70 38 3 121 3 lexA LexA repressor Mycobacterium sp. (strain MCS)
A1UF04 3.23e-14 70 38 3 121 3 lexA LexA repressor Mycobacterium sp. (strain KMS)
A3PYG6 3.23e-14 70 38 3 121 3 lexA LexA repressor Mycobacterium sp. (strain JLS)
A8GKB4 3.28e-14 69 34 4 150 3 lexA LexA repressor Serratia proteamaculans (strain 568)
Q7MQ85 4.93e-14 69 35 3 119 3 lexA LexA repressor Vibrio vulnificus (strain YJ016)
Q8DD47 4.93e-14 69 35 3 119 3 lexA LexA repressor Vibrio vulnificus (strain CMCP6)
Q21U48 5.7e-14 69 35 3 127 3 lexA LexA repressor Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1JRT9 5.96e-14 68 33 4 150 3 lexA LexA repressor Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A1SND2 6.28e-14 69 39 3 119 3 lexA LexA repressor Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q2NR09 6.69e-14 68 33 4 150 3 lexA LexA repressor Sodalis glossinidius (strain morsitans)
Q2IIJ0 9.06e-14 68 35 3 132 3 lexA LexA repressor Anaeromyxobacter dehalogenans (strain 2CP-C)
B4UCX8 9.28e-14 68 35 3 132 3 lexA LexA repressor Anaeromyxobacter sp. (strain K)
B8JA57 1.05e-13 68 35 3 132 3 lexA LexA repressor Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A1W897 1.12e-13 68 35 4 128 3 lexA LexA repressor Acidovorax sp. (strain JS42)
B9MI78 1.12e-13 68 35 4 128 3 lexA LexA repressor Acidovorax ebreus (strain TPSY)
B1JNE3 1.15e-13 68 33 4 150 3 lexA LexA repressor Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FG7 1.15e-13 68 33 4 150 3 lexA LexA repressor Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRU5 1.15e-13 68 33 4 150 3 lexA LexA repressor Yersinia pestis (strain Pestoides F)
Q1CE98 1.15e-13 68 33 4 150 3 lexA LexA repressor Yersinia pestis bv. Antiqua (strain Nepal516)
A9R273 1.15e-13 68 33 4 150 3 lexA LexA repressor Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ16 1.15e-13 68 33 4 150 3 lexA LexA repressor Yersinia pestis
B2K1U7 1.15e-13 68 33 4 150 3 lexA LexA repressor Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0U1 1.15e-13 68 33 4 150 3 lexA LexA repressor Yersinia pestis bv. Antiqua (strain Antiqua)
A7FN96 1.15e-13 68 33 4 150 3 lexA LexA repressor Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1TQ93 1.27e-13 68 35 4 128 3 lexA LexA repressor Paracidovorax citrulli (strain AAC00-1)
A1WSJ3 1.39e-13 68 36 3 122 3 lexA LexA repressor Verminephrobacter eiseniae (strain EF01-2)
A9IR25 1.46e-13 68 35 4 128 3 lexA LexA repressor Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q39VQ1 1.49e-13 67 36 3 119 3 lexA LexA repressor Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
C5CKV7 1.66e-13 68 36 4 136 3 lexA LexA repressor Variovorax paradoxus (strain S110)
Q5QUP5 1.8e-13 67 36 3 119 3 lexA LexA repressor Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q7MZB8 1.91e-13 67 32 4 149 3 lexA LexA repressor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4W5F6 2.25e-13 67 34 5 151 3 lexA LexA repressor Enterobacter sp. (strain 638)
Q5P4A1 3.06e-13 67 37 3 121 3 lexA LexA repressor Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q87ZB9 3.41e-13 67 33 5 153 3 lexA1 LexA repressor 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B3PEX1 3.55e-13 67 38 3 120 3 lexA LexA repressor Cellvibrio japonicus (strain Ueda107)
C6DKD2 3.63e-13 67 33 4 150 3 lexA LexA repressor Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A6TGV2 3.79e-13 67 33 4 150 3 lexA LexA repressor Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P61608 3.88e-13 67 35 3 119 3 lexA1 LexA repressor 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B0RHB3 4.02e-13 67 39 3 119 3 lexA LexA repressor Clavibacter sepedonicus
A1T7V4 4.17e-13 67 37 3 121 3 lexA LexA repressor Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B5XXY9 4.29e-13 66 33 4 150 3 lexA LexA repressor Klebsiella pneumoniae (strain 342)
Q15MZ2 4.35e-13 67 32 5 155 3 lexA LexA repressor Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B2JK89 4.72e-13 67 35 5 128 3 lexA LexA repressor Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B4S1W7 4.8e-13 66 32 5 156 3 lexA LexA repressor Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
P0A273 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A274 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella typhi
B4TQQ5 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella schwarzengrund (strain CVM19633)
B5BJW0 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella paratyphi A (strain AKU_12601)
C0Q514 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella paratyphi C (strain RKS4594)
A9N1L6 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PL14 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T1T2 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella newport (strain SL254)
B4TDM0 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella heidelberg (strain SL476)
B5R7T6 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ62 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella enteritidis PT4 (strain P125109)
B5FQR1 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella dublin (strain CT_02021853)
Q57GZ0 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella choleraesuis (strain SC-B67)
A9MGP6 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F1Q6 4.81e-13 66 33 4 150 3 lexA LexA repressor Salmonella agona (strain SL483)
A9BWH9 5.22e-13 67 37 4 127 3 lexA LexA repressor Delftia acidovorans (strain DSM 14801 / SPH-1)
B1Y250 5.28e-13 67 32 4 135 3 lexA LexA repressor Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q5GYM5 5.51e-13 66 35 3 128 3 lexA2 LexA repressor 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
P60512 5.56e-13 66 35 3 128 1 lexA LexA repressor Xanthomonas citri
P60511 5.56e-13 66 35 3 128 3 lexA2 LexA repressor 2 Xanthomonas axonopodis pv. citri (strain 306)
Q8P9X2 5.74e-13 66 35 3 128 3 lexA2 LexA repressor 2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q93MQ9 5.86e-13 66 35 3 128 3 lexA LexA repressor Xanthomonas campestris
A4TCN9 7.13e-13 66 36 3 121 3 lexA LexA repressor Mycolicibacterium gilvum (strain PYR-GCK)
Q2L247 7.75e-13 66 33 3 127 3 lexA LexA repressor Bordetella avium (strain 197N)
Q82KE0 8.27e-13 66 39 4 125 3 lexA LexA repressor Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q7VRY0 8.61e-13 66 35 4 128 3 lexA LexA repressor Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WCK0 8.61e-13 66 35 4 128 3 lexA LexA repressor Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B0SPA2 8.8e-13 65 36 3 110 3 lexA LexA repressor Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SFV4 8.8e-13 65 36 3 110 3 lexA LexA repressor Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B8HG97 9.17e-13 66 37 4 125 3 lexA LexA repressor Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
O69979 9.26e-13 66 39 4 125 3 lexA LexA repressor Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q48AA9 9.37e-13 65 32 3 121 3 lexA LexA repressor Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q04596 9.67e-13 65 32 4 150 3 lexA LexA repressor Pectobacterium carotovorum subsp. carotovorum
Q5YP21 1.04e-12 65 40 3 118 3 lexA1 LexA repressor 1 Nocardia farcinica (strain IFM 10152)
Q6D9I5 1.04e-12 65 32 4 150 3 lexA LexA repressor Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1R556 1.08e-12 66 39 4 125 3 lexA LexA repressor Paenarthrobacter aurescens (strain TC1)
B7LL15 1.11e-12 65 32 4 150 3 lexA LexA repressor Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5EJ91 1.15e-12 65 38 4 120 3 lexA LexA repressor Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JBX0 1.15e-12 65 38 4 120 3 lexA LexA repressor Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
C3LPT4 1.22e-12 65 35 3 119 3 lexA LexA repressor Vibrio cholerae serotype O1 (strain M66-2)
Q9KVP9 1.22e-12 65 35 3 119 3 lexA LexA repressor Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4F6 1.22e-12 65 35 3 119 3 lexA LexA repressor Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A9F881 1.28e-12 65 37 2 121 3 lexA LexA repressor Sorangium cellulosum (strain So ce56)
Q3YUU1 1.28e-12 65 32 4 150 3 lexA LexA repressor Shigella sonnei (strain Ss046)
P0A7C5 1.28e-12 65 32 4 150 3 lexA LexA repressor Shigella flexneri
Q0SXR0 1.28e-12 65 32 4 150 3 lexA LexA repressor Shigella flexneri serotype 5b (strain 8401)
Q327V0 1.28e-12 65 32 4 150 3 lexA LexA repressor Shigella dysenteriae serotype 1 (strain Sd197)
Q31TV1 1.28e-12 65 32 4 150 3 lexA LexA repressor Shigella boydii serotype 4 (strain Sb227)
B2TX73 1.28e-12 65 32 4 150 3 lexA LexA repressor Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R3P3 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli (strain UTI89 / UPEC)
B1LPK8 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli (strain SMS-3-5 / SECEC)
B6I5Q8 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli (strain SE11)
B7NFY7 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7C2 1.28e-12 65 32 4 150 1 lexA LexA repressor Escherichia coli (strain K12)
B1IUK9 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7C3 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA20 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIM0 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O1:K1 / APEC
A8A7E3 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O9:H4 (strain HS)
B1XC42 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli (strain K12 / DH10B)
C5A136 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli (strain K12 / MC4100 / BW2952)
B7M7V6 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O8 (strain IAI1)
B7N2Q0 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O81 (strain ED1a)
B7NSK5 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z184 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7C4 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O157:H7
B7LAZ0 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli (strain 55989 / EAEC)
B7MJ33 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPK4 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUR5 1.28e-12 65 32 4 150 3 lexA LexA repressor Escherichia coli O139:H28 (strain E24377A / ETEC)
Q13ZI7 1.3e-12 65 36 5 128 3 lexA LexA repressor Paraburkholderia xenovorans (strain LB400)
P0A154 1.39e-12 65 36 4 130 3 lexA LexA repressor Pseudomonas putida
P0A153 1.39e-12 65 36 4 130 3 lexA1 LexA repressor 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P59479 1.41e-12 65 34 3 126 3 lexA2 LexA repressor 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A4STB3 1.41e-12 65 34 3 119 3 lexA LexA repressor Aeromonas salmonicida (strain A449)
Q314F2 1.5e-12 65 39 2 111 3 lexA LexA repressor Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A7MPP3 1.51e-12 65 32 4 150 3 lexA LexA repressor Cronobacter sakazakii (strain ATCC BAA-894)
A6TR70 1.62e-12 65 36 4 133 3 lexA LexA repressor Alkaliphilus metalliredigens (strain QYMF)
Q8XZU1 1.72e-12 65 35 5 128 3 lexA LexA repressor Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q65UK9 1.76e-12 65 34 3 120 3 lexA LexA repressor Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A0L9E2 1.79e-12 65 38 3 126 3 lexA LexA repressor Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B0USF0 1.85e-12 65 35 3 120 3 lexA LexA repressor Histophilus somni (strain 2336)
Q0I2G7 1.85e-12 65 35 3 120 3 lexA LexA repressor Histophilus somni (strain 129Pt)
Q7W0T5 1.93e-12 65 34 4 128 3 lexA LexA repressor Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q2SVP7 2.03e-12 65 35 5 128 3 lexA LexA repressor Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8G4R6 2.04e-12 65 36 4 130 3 lexA LexA repressor Bifidobacterium longum (strain NCC 2705)
B3DQB4 2.04e-12 65 36 4 130 3 lexA LexA repressor Bifidobacterium longum (strain DJO10A)
C5B718 2.09e-12 65 32 4 150 3 lexA LexA repressor Edwardsiella ictaluri (strain 93-146)
Q63TX7 2.09e-12 65 35 5 128 3 lexA LexA repressor Burkholderia pseudomallei (strain K96243)
A3N959 2.09e-12 65 35 5 128 3 lexA LexA repressor Burkholderia pseudomallei (strain 668)
Q3JSP6 2.09e-12 65 35 5 128 3 lexA LexA repressor Burkholderia pseudomallei (strain 1710b)
A3NUV3 2.09e-12 65 35 5 128 3 lexA LexA repressor Burkholderia pseudomallei (strain 1106a)
A1V472 2.09e-12 65 35 5 128 3 lexA LexA repressor Burkholderia mallei (strain SAVP1)
Q62K79 2.09e-12 65 35 5 128 3 lexA LexA repressor Burkholderia mallei (strain ATCC 23344)
A2S339 2.09e-12 65 35 5 128 3 lexA LexA repressor Burkholderia mallei (strain NCTC 10229)
A3MJD2 2.09e-12 65 35 5 128 3 lexA LexA repressor Burkholderia mallei (strain NCTC 10247)
Q187P1 2.21e-12 65 37 5 126 3 lexA LexA repressor Clostridioides difficile (strain 630)
B2VKA1 2.24e-12 64 32 4 150 3 lexA LexA repressor Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7GQ64 2.31e-12 65 36 4 130 3 lexA LexA repressor Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
A4XSN5 2.31e-12 64 33 5 155 3 lexA LexA repressor Pseudomonas mendocina (strain ymp)
A8AN85 2.52e-12 64 32 4 150 3 lexA LexA repressor Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4JE56 2.52e-12 65 34 5 129 3 lexA LexA repressor Burkholderia vietnamiensis (strain G4 / LMG 22486)
B2T3L9 2.6e-12 65 35 5 128 3 lexA LexA repressor Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q0BFL9 2.91e-12 64 34 5 129 3 lexA LexA repressor Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q39GT3 3.06e-12 64 34 5 129 3 lexA LexA repressor Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1YPM6 3.06e-12 64 34 5 129 3 lexA LexA repressor Burkholderia ambifaria (strain MC40-6)
A5UHQ3 3.4e-12 64 33 3 120 3 lexA LexA repressor Haemophilus influenzae (strain PittGG)
A5UDX6 3.4e-12 64 33 3 120 3 lexA LexA repressor Haemophilus influenzae (strain PittEE)
Q4QME9 3.4e-12 64 33 3 120 3 lexA LexA repressor Haemophilus influenzae (strain 86-028NP)
A0JUZ2 3.45e-12 65 38 4 125 3 lexA LexA repressor Arthrobacter sp. (strain FB24)
P61609 3.52e-12 64 37 3 119 3 lexA2 LexA repressor 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
O86847 3.8e-12 64 38 4 125 3 lexA LexA repressor Streptomyces clavuligerus
Q49848 3.9e-12 64 36 3 122 3 lexA LexA repressor Mycobacterium leprae (strain TN)
B8ZQU5 3.9e-12 64 36 3 122 3 lexA LexA repressor Mycobacterium leprae (strain Br4923)
Q44069 4.69e-12 63 33 3 119 3 lexA LexA repressor Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8KT78 4.74e-12 63 32 5 153 3 lexA LexA repressor Pseudomonas chlororaphis
P57917 4.81e-12 63 30 4 156 3 lexA LexA repressor Pasteurella multocida (strain Pm70)
Q07267 4.95e-12 63 32 4 153 3 lexA LexA repressor Providencia rettgeri
Q67NM2 5.16e-12 63 38 3 120 3 lexA LexA repressor Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B8I2Q1 5.35e-12 63 38 3 119 3 lexA LexA repressor Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
P44858 6.2e-12 63 33 3 120 3 lexA LexA repressor Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B1MCZ5 7.3e-12 63 34 4 141 3 lexA LexA repressor Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A9AIX7 7.99e-12 63 34 5 129 3 lexA LexA repressor Burkholderia multivorans (strain ATCC 17616 / 249)
Q5YT43 8.36e-12 63 38 3 121 3 lexA2 LexA repressor 2 Nocardia farcinica (strain IFM 10152)
C4L7X7 8.51e-12 63 36 4 120 3 lexA LexA repressor Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q1BWH8 9.43e-12 63 34 5 129 3 lexA LexA repressor Burkholderia orbicola (strain AU 1054)
B1K0Z6 9.43e-12 63 34 5 129 3 lexA LexA repressor Burkholderia orbicola (strain MC0-3)
A0K775 9.43e-12 63 34 5 129 3 lexA LexA repressor Burkholderia cenocepacia (strain HI2424)
Q8XL81 9.73e-12 63 33 2 117 3 lexA LexA repressor Clostridium perfringens (strain 13 / Type A)
A6SXJ3 9.73e-12 63 35 5 130 3 lexA LexA repressor Janthinobacterium sp. (strain Marseille)
B4E8S4 9.82e-12 63 34 5 129 3 lexA LexA repressor Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q0TRD0 1.34e-11 62 33 2 117 3 lexA LexA repressor Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A5IN94 1.44e-11 62 32 3 136 3 lexA LexA repressor Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A6VX60 1.48e-11 62 33 3 118 3 lexA LexA repressor Marinomonas sp. (strain MWYL1)
Q0STQ8 1.52e-11 62 33 2 117 3 lexA LexA repressor Clostridium perfringens (strain SM101 / Type A)
P9WHR7 1.77e-11 62 35 3 121 1 lexA LexA repressor Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHR6 1.77e-11 62 35 3 121 3 lexA LexA repressor Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U672 1.77e-11 62 35 3 121 3 lexA LexA repressor Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFH9 1.77e-11 62 35 3 121 3 lexA LexA repressor Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KM58 1.77e-11 62 35 3 121 3 lexA LexA repressor Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TY15 1.77e-11 62 35 3 121 3 lexA LexA repressor Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q4JV87 1.94e-11 63 39 3 119 3 lexA LexA repressor Corynebacterium jeikeium (strain K411)
B3R2P9 2.23e-11 62 34 4 128 3 lexA LexA repressor Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q24X76 2.28e-11 62 37 3 117 3 lexA LexA repressor Desulfitobacterium hafniense (strain Y51)
B8FWD3 2.28e-11 62 37 3 117 3 lexA LexA repressor Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
C5BIH2 2.39e-11 62 33 5 150 3 lexA LexA repressor Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q0K9E3 2.44e-11 62 34 4 128 3 lexA LexA repressor Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P0DN68 2.91e-11 62 34 3 134 1 lexA LexA repressor Fibrobacter succinogenes (strain ATCC 19169 / S85)
A0QIQ3 3.03e-11 62 35 3 121 3 lexA LexA repressor Mycobacterium avium (strain 104)
Q6AE10 4e-11 62 38 4 123 3 lexA LexA repressor Leifsonia xyli subsp. xyli (strain CTCB07)
B2UAG1 4.03e-11 61 35 5 128 3 lexA LexA repressor Ralstonia pickettii (strain 12J)
A4G713 4.58e-11 61 33 5 130 3 lexA LexA repressor Herminiimonas arsenicoxydans
Q1D406 5e-11 61 35 4 130 3 lexA LexA repressor Myxococcus xanthus (strain DK1622)
A1WXU3 5.8e-11 61 36 3 119 3 lexA LexA repressor Halorhodospira halophila (strain DSM 244 / SL1)
B1L838 6.12e-11 60 32 3 136 3 lexA LexA repressor Thermotoga sp. (strain RQ2)
B2HLX8 6.25e-11 61 34 4 127 3 lexA LexA repressor Mycobacterium marinum (strain ATCC BAA-535 / M)
Q3A3S5 6.49e-11 60 42 1 89 3 lexA LexA repressor Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
O33927 6.71e-11 60 32 3 136 1 lexA LexA repressor Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q47EP6 7.02e-11 60 34 4 133 3 lexA LexA repressor Dechloromonas aromatica (strain RCB)
A1SR67 7.05e-11 60 32 4 131 3 lexA LexA repressor Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A1VNK0 7.29e-11 61 32 4 131 3 lexA LexA repressor Polaromonas naphthalenivorans (strain CJ2)
A5D2J8 7.68e-11 60 36 5 133 3 lexA LexA repressor Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B8F317 1.01e-10 60 32 3 119 3 lexA LexA repressor Glaesserella parasuis serovar 5 (strain SH0165)
A0PT76 1.08e-10 60 33 4 127 3 lexA LexA repressor Mycobacterium ulcerans (strain Agy99)
Q21JT2 1.12e-10 60 30 5 150 3 lexA LexA repressor Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
O86948 1.17e-10 60 30 3 136 3 lexA LexA repressor Thermotoga neapolitana
C1DQZ4 1.27e-10 60 34 3 118 3 lexA LexA repressor Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9KAD3 1.3e-10 60 34 5 132 3 lexA LexA repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B9K9N0 1.4e-10 60 31 3 135 3 lexA LexA repressor Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q7VNI6 1.44e-10 60 33 4 127 3 lexA LexA repressor Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6VMQ0 1.53e-10 60 32 3 120 3 lexA LexA repressor Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B4EYR3 1.66e-10 59 32 3 119 3 lexA LexA repressor Proteus mirabilis (strain HI4320)
B3GXZ4 1.97e-10 59 34 3 119 3 lexA LexA repressor Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BQ48 2.05e-10 59 34 3 119 3 lexA LexA repressor Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N1B4 2.05e-10 59 34 3 119 3 lexA LexA repressor Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P61612 2.23e-10 60 34 3 121 3 lexA LexA repressor Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A9KUW8 2.8e-10 59 38 3 119 3 lexA LexA repressor Shewanella baltica (strain OS195)
A6WU05 2.8e-10 59 38 3 119 3 lexA LexA repressor Shewanella baltica (strain OS185)
A3CYX7 2.8e-10 59 38 3 119 3 lexA LexA repressor Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8ECL9 2.8e-10 59 38 3 119 3 lexA LexA repressor Shewanella baltica (strain OS223)
B8FIX5 3.08e-10 59 34 4 128 3 lexA LexA repressor Desulfatibacillum aliphaticivorans
A0Q0N2 3.35e-10 58 30 3 125 3 lexA LexA repressor Clostridium novyi (strain NT)
Q053A1 3.94e-10 58 30 2 126 3 lexA LexA repressor Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RH1 3.94e-10 58 30 2 126 3 lexA LexA repressor Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A5I2R7 4.04e-10 58 35 3 102 3 lexA LexA repressor Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FUK4 4.04e-10 58 35 3 102 3 lexA LexA repressor Clostridium botulinum (strain ATCC 19397 / Type A)
B1KS97 4.12e-10 58 35 3 102 3 lexA LexA repressor Clostridium botulinum (strain Loch Maree / Type A3)
A7GE39 4.12e-10 58 35 3 102 3 lexA LexA repressor Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IM63 4.12e-10 58 35 3 102 3 lexA LexA repressor Clostridium botulinum (strain Okra / Type B1)
C1FNT4 4.12e-10 58 35 3 102 3 lexA LexA repressor Clostridium botulinum (strain Kyoto / Type A2)
C3KX30 4.12e-10 58 35 3 102 3 lexA LexA repressor Clostridium botulinum (strain 657 / Type Ba4)
P61607 5.05e-10 58 42 2 88 3 lexA LexA repressor Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A5N8J0 5.18e-10 58 35 1 101 3 lexA LexA repressor Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E1Z5 5.18e-10 58 35 1 101 3 lexA LexA repressor Clostridium kluyveri (strain NBRC 12016)
Q2J779 5.62e-10 58 36 3 121 3 lexA LexA repressor Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A4J5P4 5.69e-10 58 33 4 127 3 lexA LexA repressor Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
C6DZY8 5.97e-10 58 36 4 121 3 lexA LexA repressor Geobacter sp. (strain M21)
Q895H6 7.16e-10 58 33 2 116 3 lexA LexA repressor Clostridium tetani (strain Massachusetts / E88)
P37452 7.23e-10 58 31 5 155 1 lexA LexA repressor Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PH1 7.23e-10 58 31 5 155 3 lexA LexA repressor Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYS3 7.23e-10 58 31 5 155 3 lexA LexA repressor Pseudomonas aeruginosa (strain LESB58)
A8LMK0 8.16e-10 58 38 2 99 3 lexA LexA repressor Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q089E2 8.78e-10 57 37 3 119 3 lexA LexA repressor Shewanella frigidimarina (strain NCIMB 400)
Q46ZR1 9.21e-10 58 33 5 129 3 lexA LexA repressor Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8F663 9.81e-10 57 32 1 104 3 lexA LexA repressor Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P61611 9.81e-10 57 32 1 104 3 lexA LexA repressor Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B5EA68 1.09e-09 57 35 4 121 3 lexA LexA repressor Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q0A9N9 1.21e-09 57 33 3 119 3 lexA LexA repressor Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A6V389 1.49e-09 57 30 5 155 3 lexA LexA repressor Pseudomonas aeruginosa (strain PA7)
Q97I23 1.69e-09 57 27 3 129 3 lexA LexA repressor Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B7VM94 1.8e-09 57 36 3 119 3 lexA LexA repressor Vibrio atlanticus (strain LGP32)
Q2RJF5 2.39e-09 56 34 5 135 3 lexA LexA repressor Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8NP86 2.45e-09 57 34 3 119 3 lexA LexA repressor Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A1U269 2.48e-09 56 32 5 150 3 lexA LexA repressor Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q605V8 2.51e-09 56 35 3 122 3 lexA LexA repressor Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0RDY1 2.54e-09 57 34 3 121 3 lexA LexA repressor Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A4QET8 2.78e-09 57 34 3 119 3 lexA LexA repressor Corynebacterium glutamicum (strain R)
A7GR32 2.97e-09 56 34 3 120 3 lexA LexA repressor Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q6HFB0 3.36e-09 56 32 4 128 3 lexA LexA repressor Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q637D7 3.36e-09 56 32 4 128 3 lexA LexA repressor Bacillus cereus (strain ZK / E33L)
Q81A92 3.36e-09 56 32 4 128 3 lexA LexA repressor Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IUL2 3.36e-09 56 32 4 128 3 lexA LexA repressor Bacillus cereus (strain Q1)
P61606 3.36e-09 56 32 4 128 3 lexA LexA repressor Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JIC6 3.36e-09 56 32 4 128 3 lexA LexA repressor Bacillus cereus (strain AH820)
Q81Y06 3.36e-09 56 32 4 128 3 lexA LexA repressor Bacillus anthracis
A0RH75 3.36e-09 56 32 4 128 3 lexA LexA repressor Bacillus thuringiensis (strain Al Hakam)
A0L2D8 3.79e-09 56 37 3 119 3 lexA LexA repressor Shewanella sp. (strain ANA-3)
A8MFC9 4.51e-09 55 35 3 119 3 lexA LexA repressor Alkaliphilus oremlandii (strain OhILAs)
Q9ZFA4 4.69e-09 56 34 3 116 1 lexA LexA repressor Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PHK4 4.69e-09 56 34 3 116 3 lexA LexA repressor Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A9VPX5 5.03e-09 55 32 4 128 3 lexA LexA repressor Bacillus mycoides (strain KBAB4)
A1RE93 5.15e-09 55 36 3 119 3 lexA LexA repressor Shewanella sp. (strain W3-18-1)
A4YC04 5.15e-09 55 36 3 119 3 lexA LexA repressor Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B2IKM0 5.22e-09 56 41 4 100 3 lexA LexA repressor Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A8FDP7 6.84e-09 55 33 4 132 3 lexA LexA repressor Bacillus pumilus (strain SAFR-032)
Q0HDL5 6.98e-09 55 37 3 119 3 lexA LexA repressor Shewanella sp. (strain MR-4)
Q8FPF5 7.26e-09 55 33 3 119 3 lexA LexA repressor Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8E8Q8 7.65e-09 55 36 3 119 3 lexA LexA repressor Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9AGM5 8.57e-09 55 31 5 129 3 lexA LexA repressor Cupriavidus necator
Q1LLW6 8.57e-09 55 31 5 129 3 lexA LexA repressor Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4WX64 9.49e-09 55 34 3 115 3 lexA LexA repressor Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q0HPW6 1.21e-08 54 36 3 119 3 lexA LexA repressor Shewanella sp. (strain MR-7)
Q0AY82 1.67e-08 54 31 4 131 3 lexA LexA repressor Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
C5D9K3 1.87e-08 54 35 3 118 3 lexA LexA repressor Geobacillus sp. (strain WCH70)
A8L6K4 2.07e-08 54 34 4 125 3 lexA LexA repressor Parafrankia sp. (strain EAN1pec)
Q28R71 3.6e-08 53 30 4 138 3 lexA LexA repressor Jannaschia sp. (strain CCS1)
A7N0W6 6.96e-08 52 34 3 119 3 lexA LexA repressor Vibrio campbellii (strain ATCC BAA-1116)
P65820 1.42e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain N315)
P65819 1.42e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YXS8 1.42e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain bovine RF122 / ET3-1)
A7X1Z4 1.42e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q87KN2 1.42e-07 52 34 3 119 3 lexA LexA repressor Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q93SM0 1.44e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain MW2)
Q6G9L9 1.44e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain MSSA476)
Q6GH67 1.44e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain MRSA252)
Q9L4P1 1.44e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain COL)
Q2FYU1 1.44e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH94 1.44e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain USA300)
Q5WG03 1.47e-07 52 31 4 135 3 lexA LexA repressor Shouchella clausii (strain KSM-K16)
Q49XD4 1.51e-07 52 33 4 121 3 lexA LexA repressor Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q65J42 1.76e-07 51 34 3 120 3 lexA LexA repressor Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A6QGP1 1.78e-07 51 33 4 121 3 lexA LexA repressor Staphylococcus aureus (strain Newman)
A4IMK1 1.78e-07 51 35 3 118 3 lexA LexA repressor Geobacillus thermodenitrificans (strain NG80-2)
Q5L0C3 1.89e-07 51 35 3 118 3 lexA LexA repressor Geobacillus kaustophilus (strain HTA426)
Q163X5 2.12e-07 51 29 4 138 3 lexA LexA repressor Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1GHJ8 2.99e-07 51 28 3 122 3 lexA LexA repressor Ruegeria sp. (strain TM1040)
P44249 3.01e-07 50 36 0 66 3 HI_1546 Uncharacterized protein HI_1546 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B8EK86 3.11e-07 51 38 3 99 3 lexA LexA repressor Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B9DP69 3.25e-07 50 33 4 121 3 lexA LexA repressor Staphylococcus carnosus (strain TM300)
P31080 3.32e-07 50 32 3 120 1 lexA LexA repressor Bacillus subtilis (strain 168)
Q3SRJ0 3.62e-07 51 32 4 121 3 lexA LexA repressor Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A0AIA3 5.22e-07 50 32 3 121 3 lexA LexA repressor Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B0S1C5 5.68e-07 50 31 4 132 3 lexA LexA repressor Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B5FCB2 6.54e-07 50 34 4 129 3 lexA LexA repressor Aliivibrio fischeri (strain MJ11)
Q1QVT7 6.89e-07 50 36 2 99 3 lexA LexA repressor Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5E209 7.01e-07 50 34 4 129 3 lexA LexA repressor Aliivibrio fischeri (strain ATCC 700601 / ES114)
P61613 7.97e-07 50 32 5 137 3 lexA LexA repressor Rhodobacter capsulatus
A7Z552 8.25e-07 49 30 4 132 3 lexA LexA repressor Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B1HRJ5 8.35e-07 49 31 4 126 3 lexA LexA repressor Lysinibacillus sphaericus (strain C3-41)
Q8Y7H7 8.88e-07 49 31 3 121 3 lexA LexA repressor Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DG25 8.96e-07 49 31 4 129 3 lexA LexA repressor Listeria monocytogenes serotype 4a (strain HCC23)
Q720B9 8.96e-07 49 31 4 129 3 lexA LexA repressor Listeria monocytogenes serotype 4b (strain F2365)
C1L2K9 8.96e-07 49 31 4 129 3 lexA LexA repressor Listeria monocytogenes serotype 4b (strain CLIP80459)
B6IST2 1.04e-06 49 32 4 108 3 lexA LexA repressor Rhodospirillum centenum (strain ATCC 51521 / SW)
B1YE71 1.2e-06 49 32 4 120 3 lexA LexA repressor Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
C0ZES6 1.33e-06 49 35 5 126 3 lexA LexA repressor Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B6ENU0 1.37e-06 49 32 4 132 3 lexA LexA repressor Aliivibrio salmonicida (strain LFI1238)
Q2RT47 1.46e-06 49 33 4 105 3 lexA LexA repressor Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A5EK34 1.61e-06 49 35 3 99 3 lexA LexA repressor Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q5HPK2 1.8e-06 48 35 3 102 3 lexA LexA repressor Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4YVE6 1.82e-06 48 35 3 99 3 lexA LexA repressor Bradyrhizobium sp. (strain ORS 278)
B6JG34 2.35e-06 48 35 3 99 3 lexA LexA repressor Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q92C51 2.39e-06 48 31 4 128 3 lexA LexA repressor Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q2IW99 2.4e-06 48 35 3 99 3 lexA LexA repressor Rhodopseudomonas palustris (strain HaA2)
Q049T1 2.65e-06 48 34 4 122 3 lexA LexA repressor Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9M5 2.65e-06 48 34 4 122 3 lexA LexA repressor Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q6LVS1 2.76e-06 48 35 3 119 3 lexA LexA repressor Photobacterium profundum (strain SS9)
Q1QMK3 3.02e-06 48 35 3 99 3 lexA LexA repressor Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q0BTY8 3.04e-06 48 34 4 116 3 lexA LexA repressor Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q215D1 3.05e-06 48 34 3 99 3 lexA LexA repressor Rhodopseudomonas palustris (strain BisB18)
Q136C2 3.08e-06 48 35 3 99 3 lexA LexA repressor Rhodopseudomonas palustris (strain BisB5)
A1B3Z0 3.69e-06 48 33 2 99 3 lexA LexA repressor Paracoccus denitrificans (strain Pd 1222)
Q4L648 3.9e-06 47 32 4 121 3 lexA LexA repressor Staphylococcus haemolyticus (strain JCSC1435)
Q07NH5 4.18e-06 48 34 3 99 3 lexA LexA repressor Rhodopseudomonas palustris (strain BisA53)
Q1GUX2 4.68e-06 47 33 4 104 3 lexA LexA repressor Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q89KS7 6.62e-06 47 34 3 99 3 lexA LexA repressor Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B4RBX6 8.79e-06 47 35 3 97 3 lexA LexA repressor Phenylobacterium zucineum (strain HLK1)
B8IN87 9.92e-06 47 34 4 109 3 lexA LexA repressor Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q5FNN8 1.06e-05 47 34 4 103 3 lexA LexA repressor Gluconobacter oxydans (strain 621H)
A9BGA3 1.18e-05 46 36 3 88 3 lexA LexA repressor Petrotoga mobilis (strain DSM 10674 / SJ95)
A9HJ64 1.44e-05 46 32 4 117 3 lexA LexA repressor Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A5G2J1 1.54e-05 46 34 4 103 3 lexA LexA repressor Acidiphilium cryptum (strain JF-5)
Q0C1A3 1.57e-05 46 43 2 66 3 lexA LexA repressor Hyphomonas neptunium (strain ATCC 15444)
Q2W3A5 1.78e-05 46 33 4 103 3 lexA LexA repressor Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q5LRH4 1.85e-05 46 33 3 99 3 lexA LexA repressor Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8EQM5 2.13e-05 45 30 3 120 3 lexA LexA repressor Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A7HY01 2.2e-05 46 37 5 101 3 lexA LexA repressor Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q4FM55 2.21e-05 45 31 3 96 3 lexA LexA repressor Pelagibacter ubique (strain HTCC1062)
C4L2T2 3.36e-05 45 32 4 120 3 lexA LexA repressor Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q38W54 4.04e-05 45 31 6 139 3 lexA LexA repressor Latilactobacillus sakei subsp. sakei (strain 23K)
Q5NR31 4.12e-05 45 33 3 90 3 lexA LexA repressor Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A5VB97 4.44e-05 45 33 5 106 3 lexA LexA repressor Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A8F429 4.69e-05 44 27 5 144 3 lexA LexA repressor Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
A6LM87 5.67e-05 44 24 2 117 3 lexA LexA repressor Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B0UGH4 6.16e-05 44 35 3 99 3 lexA LexA repressor Methylobacterium sp. (strain 4-46)
Q9A724 6.72e-05 44 27 3 118 3 lexA LexA repressor Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2NA93 6.83e-05 44 32 7 127 3 lexA LexA repressor Erythrobacter litoralis (strain HTCC2594)
A8YVS7 7.25e-05 44 31 4 129 3 lexA LexA repressor Lactobacillus helveticus (strain DPC 4571)
A6X0K7 7.34e-05 44 34 3 99 3 lexA LexA repressor Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B0SYZ8 7.58e-05 44 28 3 117 3 lexA LexA repressor Caulobacter sp. (strain K31)
A8I825 7.69e-05 44 34 3 99 3 lexA LexA repressor Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B3Q6P2 8.15e-05 44 33 3 99 3 lexA LexA repressor Rhodopseudomonas palustris (strain TIE-1)
P61614 8.15e-05 44 33 3 99 3 lexA LexA repressor Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B1ZZZ4 0.000124 43 32 5 123 1 lexA LexA repressor Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q2G6Q5 0.000125 43 40 2 67 3 lexA LexA repressor Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P75974 0.000152 43 52 2 51 4 cohE Prophage repressor CohE Escherichia coli (strain K12)
Q1IU64 0.000192 43 31 5 122 3 lexA LexA repressor Koribacter versatilis (strain Ellin345)
A7INJ8 0.000192 43 33 3 99 3 lexA LexA repressor Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q834R0 0.000229 43 33 5 124 3 lexA LexA repressor Enterococcus faecalis (strain ATCC 700802 / V583)
B1LUJ7 0.000241 43 33 3 99 3 lexA LexA repressor Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B9JEY4 0.000274 42 34 4 105 3 lexA LexA repressor Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q03B55 0.00028 42 28 4 142 3 lexA LexA repressor Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WC17 0.00028 42 28 4 142 3 lexA LexA repressor Lacticaseibacillus casei (strain BL23)
Q8YHG1 0.000353 42 34 3 99 3 lexA LexA repressor Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8G0F1 0.000449 42 34 3 99 3 lexA LexA repressor Brucella suis biovar 1 (strain 1330)
B0CGU2 0.000449 42 34 3 99 3 lexA LexA repressor Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQR8 0.000449 42 34 3 99 3 lexA LexA repressor Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
C0RJB4 0.000449 42 34 3 99 3 lexA LexA repressor Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5F7 0.000449 42 34 3 99 3 lexA LexA repressor Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CZ5 0.000449 42 34 3 99 3 lexA LexA repressor Brucella abortus biovar 1 (strain 9-941)
Q2YRR1 0.000449 42 34 3 99 3 lexA LexA repressor Brucella abortus (strain 2308)
B2S5Z4 0.000449 42 34 3 99 3 lexA LexA repressor Brucella abortus (strain S19)
Q6G5D9 0.000476 42 35 4 87 3 lexA LexA repressor Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A9B5H8 0.000484 42 34 3 90 3 lexA LexA repressor Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q0APU7 0.000491 42 43 2 66 3 lexA LexA repressor Maricaulis maris (strain MCS10)
B7IDD1 0.000697 41 24 2 117 3 lexA LexA repressor Thermosipho africanus (strain TCF52B)
P61610 0.000739 41 31 3 118 3 lexA LexA repressor Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q044D8 0.000761 41 31 3 118 3 lexA LexA repressor Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12280
Feature type CDS
Gene umuD
Product translesion error-prone DNA polymerase V autoproteolytic subunit
Location 2724786 - 2725235 (strand: 1)
Length 450 (nucleotides) / 149 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2996
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00717 Peptidase S24-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1974 Transcription (K)
Signal transduction mechanisms (T)		 KT SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03503 DNA polymerase V [EC:3.4.21.-] - -

Protein Sequence

MSVSLICRSGALAFIKAKRLRIPLFMERVSAGFPSPAQDYVEQTLDLNELCIKRPAATFFVRVEGDSMIDAGIHPDDILVVDRSVQAEHGDIVIAGIHGELTVKELQLRPCVMLIPRNQAYEPIHVSEGTELEIFGVVTNVVRNMRRKS

Flanking regions ( +/- flanking 50bp)

AGATACTGTATAAATAAACAGTATCAATTGTGATTTTTTCGAGGTTCGTCATGAGTGTCTCGCTGATATGCCGTAGCGGCGCACTTGCCTTCATCAAAGCCAAGCGCCTTCGTATTCCATTGTTTATGGAACGTGTTTCTGCTGGTTTTCCCTCACCAGCGCAGGATTATGTTGAGCAAACGCTCGACCTCAACGAGCTGTGCATCAAGCGACCGGCTGCAACCTTCTTTGTGCGTGTTGAAGGTGATTCAATGATTGATGCTGGGATTCACCCAGATGATATTTTGGTGGTTGATCGATCTGTCCAAGCCGAACACGGTGACATTGTCATCGCGGGTATCCATGGTGAACTCACGGTAAAGGAGCTTCAACTAAGGCCGTGCGTCATGCTGATCCCAAGAAACCAGGCGTATGAGCCCATTCATGTTTCTGAAGGGACAGAGTTAGAGATATTTGGTGTGGTCACCAATGTGGTGCGAAACATGCGCCGCAAGTCGTGACTATCCCATGCCAGTATTTGCCTTGGTGGACTGCAACAACTTTTACGCTA