Homologs in group_38

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00315 FBDBKF_00315 38.1 Morganella morganii S1 - Single-stranded DNA-binding protein
FBDBKF_17025 FBDBKF_17025 38.3 Morganella morganii S1 ssb Single-stranded DNA-binding protein
EHELCC_01230 EHELCC_01230 38.1 Morganella morganii S2 - Single-stranded DNA-binding protein
EHELCC_16565 EHELCC_16565 38.3 Morganella morganii S2 ssb Single-stranded DNA-binding protein
NLDBIP_02230 NLDBIP_02230 38.1 Morganella morganii S4 - Single-stranded DNA-binding protein
NLDBIP_16775 NLDBIP_16775 38.3 Morganella morganii S4 ssb Single-stranded DNA-binding protein
LHKJJB_03745 LHKJJB_03745 38.1 Morganella morganii S3 - Single-stranded DNA-binding protein
LHKJJB_16695 LHKJJB_16695 38.3 Morganella morganii S3 ssb Single-stranded DNA-binding protein
HKOGLL_03300 HKOGLL_03300 38.1 Morganella morganii S5 - Single-stranded DNA-binding protein
HKOGLL_17660 HKOGLL_17660 38.3 Morganella morganii S5 ssb Single-stranded DNA-binding protein
F4V73_RS18505 F4V73_RS18505 39.6 Morganella psychrotolerans - single-stranded DNA-binding protein
PMI_RS04420 PMI_RS04420 40.9 Proteus mirabilis HI4320 ssb single-stranded DNA-binding protein
PMI_RS13540 PMI_RS13540 38.3 Proteus mirabilis HI4320 ssb1 single-stranded DNA-binding protein SSB1

Distribution of the homologs in the orthogroup group_38

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_38

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8Y2B4 4.62e-27 102 43 1 109 3 ssb Single-stranded DNA-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q83EP4 7.91e-27 100 43 2 109 1 ssb Single-stranded DNA-binding protein Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P28044 2.19e-26 100 38 3 139 1 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
P18310 2.24e-26 100 37 3 139 3 ssbF Plasmid-derived single-stranded DNA-binding protein Escherichia coli (strain K12)
P18022 3.09e-26 100 37 3 132 3 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
P28045 3.79e-26 99 37 3 132 3 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
P28043 4.62e-26 99 37 2 135 3 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
Q889U1 8.66e-25 96 37 1 135 3 ssb Single-stranded DNA-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q89A53 8.97e-25 95 43 2 100 3 ssb Single-stranded DNA-binding protein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P40947 1.02e-24 95 46 2 103 1 ssb Single-stranded DNA-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88QK5 2.41e-24 95 45 1 102 3 ssb Single-stranded DNA-binding protein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9CJP4 3.5e-24 94 40 2 113 3 ssb Single-stranded DNA-binding protein Pasteurella multocida (strain Pm70)
Q8VMM4 6.61e-24 94 44 1 102 3 ssb Single-stranded DNA-binding protein Pseudomonas putida
P44409 3.62e-23 92 38 2 113 3 ssb Single-stranded DNA-binding protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A2F6 4.95e-23 91 41 2 105 1 ssb Single-stranded DNA-binding protein 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2F7 4.95e-23 91 41 2 105 3 ssb Single-stranded DNA-binding protein 1 Salmonella typhi
Q93GP7 9.25e-23 90 47 1 87 3 ssb2 Single-stranded DNA-binding protein 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q847G1 1.28e-22 90 44 1 102 3 ssb Single-stranded DNA-binding protein Pseudomonas putida
Q1RK72 1.85e-22 89 40 3 119 3 ssb Single-stranded DNA-binding protein Rickettsia bellii (strain RML369-C)
P59930 2.77e-22 89 34 3 138 3 ssb Single-stranded DNA-binding protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8D254 5.45e-22 88 42 2 100 3 ssb Single-stranded DNA-binding protein Wigglesworthia glossinidia brevipalpis
P59927 5.63e-22 89 38 2 116 3 ssb Single-stranded DNA-binding protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8YHC2 7.89e-22 88 40 3 120 3 ssb Single-stranded DNA-binding protein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8K933 8.18e-22 88 41 2 100 3 ssb Single-stranded DNA-binding protein Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0AGE3 9.38e-22 88 44 2 100 3 ssb Single-stranded DNA-binding protein Shigella flexneri
P0AGE0 9.38e-22 88 44 2 100 1 ssb Single-stranded DNA-binding protein Escherichia coli (strain K12)
P0AGE1 9.38e-22 88 44 2 100 3 ssb Single-stranded DNA-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGE2 9.38e-22 88 44 2 100 3 ssb Single-stranded DNA-binding protein Escherichia coli O157:H7
P28046 1.07e-21 88 45 2 100 1 ssb Single-stranded DNA-binding protein Proteus mirabilis
Q8L2A6 1.18e-21 88 43 2 100 3 ssb Single-stranded DNA-binding protein Proteus vulgaris
Q9XJG4 1.21e-21 87 33 2 133 3 ssb Single-stranded DNA-binding protein Escherichia phage P1
P57610 1.62e-21 87 40 2 100 3 ssb Single-stranded DNA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8ZJ06 2.2e-21 87 43 1 97 3 ssb Single-stranded DNA-binding protein Yersinia pestis
Q8G0J1 4.32e-21 86 40 2 105 3 ssb Single-stranded DNA-binding protein Brucella suis biovar 1 (strain 1330)
Q9RHF4 7.77e-21 86 42 2 100 3 ssb2 Single-stranded DNA-binding protein 2 Salmonella typhi
P0C118 8.23e-21 85 44 1 88 3 ssb Single-stranded DNA-binding protein Brucella abortus biovar 1 (strain 9-941)
Q2YPX7 8.23e-21 85 44 1 88 3 ssb Single-stranded DNA-binding protein Brucella abortus (strain 2308)
Q89L50 1.27e-20 85 41 2 105 3 ssb Single-stranded DNA-binding protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P25762 1.56e-20 85 42 1 97 1 ssb Single-stranded DNA-binding protein Serratia marcescens
Q4UJW3 3.8e-20 83 42 3 116 3 ssb Single-stranded DNA-binding protein Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92G30 4.28e-20 83 42 3 116 3 ssb Single-stranded DNA-binding protein Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9KUW2 8.39e-20 83 43 2 100 3 ssb Single-stranded DNA-binding protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q98M41 8.61e-20 83 42 2 105 3 ssb Single-stranded DNA-binding protein Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q68Y11 9.8e-20 82 41 3 116 3 ssb Single-stranded DNA-binding protein Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q87LA3 9.94e-20 83 40 2 105 3 ssb Single-stranded DNA-binding protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P59928 1.51e-19 82 38 3 109 3 ssb Single-stranded DNA-binding protein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q9A894 1.52e-19 82 40 2 105 3 ssb Single-stranded DNA-binding protein Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P66846 1.66e-19 82 38 3 109 3 ssb Single-stranded DNA-binding protein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P66847 1.66e-19 82 38 3 109 3 ssb Single-stranded DNA-binding protein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9ZCC2 1.79e-19 82 41 3 116 3 ssb Single-stranded DNA-binding protein Rickettsia prowazekii (strain Madrid E)
Q8DCJ0 3.68e-19 81 41 2 100 3 ssb Single-stranded DNA-binding protein Vibrio vulnificus (strain CMCP6)
Q8UF87 3.7e-19 81 45 1 88 3 ssb Single-stranded DNA-binding protein Agrobacterium fabrum (strain C58 / ATCC 33970)
P56898 1.47e-18 80 44 1 88 3 ssb Single-stranded DNA-binding protein Rhizobium meliloti (strain 1021)
P77953 2.1e-18 80 36 3 111 3 ssb Single-stranded DNA-binding protein Shewanella hanedai
Q9PHE7 3.56e-18 78 37 3 108 3 ssb1 Single-stranded DNA-binding protein 1 Xylella fastidiosa (strain 9a5c)
Q82S98 4.98e-18 78 34 3 122 3 ssb Single-stranded DNA-binding protein Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P66849 7.17e-18 78 34 4 135 3 ssb Single-stranded DNA-binding protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66848 7.17e-18 78 34 4 135 3 ssb Single-stranded DNA-binding protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8EA81 1.17e-17 79 36 4 122 3 ssb Single-stranded DNA-binding protein Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9ZAQ8 3.09e-17 76 40 2 100 3 ssb Single-stranded DNA-binding protein Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8KB47 5.85e-17 75 34 4 138 3 ssb1 Single-stranded DNA-binding protein 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8P778 4.74e-16 73 37 3 108 3 ssb Single-stranded DNA-binding protein Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PIJ2 1.11e-15 72 37 3 108 3 ssb Single-stranded DNA-binding protein Xanthomonas axonopodis pv. citri (strain 306)
Q9PDI7 2.31e-14 68 36 3 108 3 ssb2 Single-stranded DNA-binding protein 2 Xylella fastidiosa (strain 9a5c)
Q87DQ5 6.07e-14 67 36 3 108 3 ssb Single-stranded DNA-binding protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8A7M7 4.12e-12 63 32 3 109 3 ssb Single-stranded DNA-binding protein Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P28042 3.55e-11 60 33 4 115 1 Ssbp1 Single-stranded DNA-binding protein, mitochondrial Rattus norvegicus
Q9CYR0 5.02e-11 60 32 4 122 1 Ssbp1 Single-stranded DNA-binding protein, mitochondrial Mus musculus
Q95KK4 6.02e-10 57 31 4 115 2 SSBP1 Single-stranded DNA-binding protein, mitochondrial Oryctolagus cuniculus
B8A5I7 8.13e-10 56 30 4 115 1 ssbp1 Single-stranded DNA-binding protein, mitochondrial Danio rerio
P09380 1.2e-09 56 32 4 116 1 ssbp1-a Single-stranded DNA-binding protein 1-A, mitochondrial Xenopus laevis
Q5RDQ0 1.5e-09 55 30 4 123 2 SSBP1 Single-stranded DNA-binding protein, mitochondrial Pongo abelii
P09381 1.67e-09 55 32 4 116 1 ssbp1-b Single-stranded DNA-binding protein 1-B, mitochondrial Xenopus laevis
Q04837 2.12e-09 55 30 4 123 1 SSBP1 Single-stranded DNA-binding protein, mitochondrial Homo sapiens
Q32PB0 7.95e-09 53 30 4 115 2 SSBP1 Single-stranded DNA-binding protein, mitochondrial Bos taurus
Q9KH06 1.56e-08 54 36 3 105 1 ssb Single-stranded DNA-binding protein Thermus aquaticus
Q8KSB6 2.73e-08 53 32 2 103 3 ssb Single-stranded DNA-binding protein Paenarthrobacter aurescens
Q928X8 8.75e-08 51 26 3 133 3 ssb3 Single-stranded DNA-binding protein 3 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8E7H6 2.34e-07 49 34 3 111 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus agalactiae serotype III (strain NEM316)
Q92FK7 2.55e-07 50 28 4 133 3 ssb2 Single-stranded DNA-binding protein 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8E220 3.27e-07 49 33 3 111 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8Y4X1 3.42e-07 50 27 3 133 3 ssb2 Single-stranded DNA-binding protein 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9X8U3 4.01e-07 50 30 2 102 1 ssb2 Single-stranded DNA-binding protein 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9CDM9 1.28e-06 48 31 4 115 3 ssb2 Single-stranded DNA-binding protein 2 Lactococcus lactis subsp. lactis (strain IL1403)
Q9RY51 1.51e-06 49 33 3 102 1 ssb Single-stranded DNA-binding protein Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q932A8 1.71e-06 47 31 3 111 3 ssb-p Single-stranded DNA-binding protein 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q82FG5 2.06e-06 48 29 2 102 3 ssb1 Single-stranded DNA-binding protein 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8E0Z9 3.2e-06 47 29 5 130 3 ssb3 Single-stranded DNA-binding protein 3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q9AFI5 3.25e-06 47 28 3 118 1 ssb Single-stranded DNA-binding protein Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P59931 3.78e-06 47 24 4 149 3 ssb Single-stranded DNA-binding protein Helicobacter hepaticus (strain ATCC 51449 / 3B1)
P9WGD5 4.23e-06 47 27 4 140 1 ssb Single-stranded DNA-binding protein Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGD4 4.23e-06 47 27 4 140 3 ssb Single-stranded DNA-binding protein Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A611 4.23e-06 47 27 4 140 3 ssb Single-stranded DNA-binding protein Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9ZJY2 5.48e-06 47 25 4 137 3 ssb Single-stranded DNA-binding protein Helicobacter pylori (strain J99 / ATCC 700824)
Q9CGS5 7.15e-06 46 32 4 112 3 ssb1 Single-stranded DNA-binding protein 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q5HJ26 1.12e-05 45 30 3 111 3 ssb-p Single-stranded DNA-binding protein 2 Staphylococcus aureus (strain COL)
P66856 1.23e-05 45 31 4 106 3 ssb2 Single-stranded DNA-binding protein 2 Tropheryma whipplei (strain Twist)
P66857 1.23e-05 45 31 4 106 3 ssb2 Single-stranded DNA-binding protein 2 Tropheryma whipplei (strain TW08/27)
Q5SLP9 1.45e-05 46 29 2 112 1 ssb Single-stranded DNA-binding protein Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q8YAR8 1.5e-05 45 28 3 111 3 ssb1 Single-stranded DNA-binding protein 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92FR5 1.52e-05 45 28 3 111 3 ssb1 Single-stranded DNA-binding protein 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8GAN5 1.73e-05 45 29 4 105 3 ssb Single-stranded DNA-binding protein Paenarthrobacter nicotinovorans
P59933 1.75e-05 45 27 3 128 3 ssb Single-stranded DNA-binding protein Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
O85824 1.77e-05 46 30 2 112 3 ssb Single-stranded DNA-binding protein Thermus thermophilus
Q9PPT7 2.72e-05 45 27 4 122 3 ssb Single-stranded DNA-binding protein Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q8NLG0 2.89e-05 45 28 2 103 3 ssb Single-stranded DNA-binding protein Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q814G6 2.99e-05 44 27 3 118 3 ssb Single-stranded DNA-binding protein Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6GCA6 3.37e-05 44 28 3 114 3 ssb2 Single-stranded DNA-binding protein 2 Staphylococcus aureus (strain MSSA476)
Q5HIS8 3.37e-05 44 28 3 114 3 ssb Single-stranded DNA-binding protein 1 Staphylococcus aureus (strain COL)
P59932 4e-05 44 28 2 107 3 ssb Single-stranded DNA-binding protein Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q899R2 4.01e-05 44 32 4 119 3 ssb Single-stranded DNA-binding protein Clostridium tetani (strain Massachusetts / E88)
P46390 4.52e-05 44 28 2 103 1 ssb Single-stranded DNA-binding protein Mycobacterium leprae (strain TN)
Q8CX55 4.59e-05 44 27 3 112 3 ssb Single-stranded DNA-binding protein Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
O25841 6.02e-05 44 25 4 137 1 ssb Single-stranded DNA-binding protein Helicobacter pylori (strain ATCC 700392 / 26695)
P66851 6.23e-05 43 32 5 115 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66850 6.23e-05 43 32 5 115 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus agalactiae serotype III (strain NEM316)
P54622 0.000161 42 30 5 114 1 mtSSB Single-stranded DNA-binding protein, mitochondrial Drosophila melanogaster
C0SPB6 0.000166 42 27 5 130 1 ssbB Single-stranded DNA-binding protein B Bacillus subtilis (strain 168)
Q8NVN2 0.000172 42 29 4 124 3 ssb Single-stranded DNA-binding protein Staphylococcus aureus (strain MW2)
Q6G7V6 0.000172 42 29 4 124 3 ssb1 Single-stranded DNA-binding protein 1 Staphylococcus aureus (strain MSSA476)
Q5XE77 0.00019 42 28 3 114 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8DSD8 0.000201 42 29 4 115 3 ssb Single-stranded DNA-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q81JI3 0.000204 42 27 3 116 3 ssb Single-stranded DNA-binding protein Bacillus anthracis
Q9WZ73 0.000311 41 29 3 109 1 ssb Single-stranded DNA-binding protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q99SQ9 0.000312 42 29 3 114 3 ssb Single-stranded DNA-binding protein Staphylococcus aureus (strain N315)
Q931K4 0.000318 42 29 3 114 3 ssb Single-stranded DNA-binding protein 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GF73 0.000331 42 29 3 114 3 ssb Single-stranded DNA-binding protein Staphylococcus aureus (strain MRSA252)
Q9K5N9 0.000474 41 28 3 111 3 ssb Single-stranded DNA-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q83NU2 0.000485 41 25 4 138 3 ssb1 Single-stranded DNA-binding protein 1 Tropheryma whipplei (strain TW08/27)
Q83N34 0.000489 41 25 4 138 3 ssb1 Single-stranded DNA-binding protein 1 Tropheryma whipplei (strain Twist)
Q839Y9 0.000532 41 28 3 112 3 ssb Single-stranded DNA-binding protein Enterococcus faecalis (strain ATCC 700802 / V583)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12105
Feature type CDS
Gene ssb
Product single-stranded DNA-binding protein
Location 2676675 - 2677094 (strand: -1)
Length 420 (nucleotides) / 139 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_38
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF00436 Single-strand binding protein family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0629 Replication, recombination and repair (L) L Single-stranded DNA-binding protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03111 single-strand DNA-binding protein DNA replication
Mismatch repair
Homologous recombination		 -

Protein Sequence

MKNQVTLIGYVGSEPETRAYPSGDLVTSISLATSEKWRDRQSNELKEHTEWHRVVFRDRGGFKLGLRAKDLIQKGAKLFVQGPQRTRSWEKDGIKHRLTEVDADEFLLLDSVNKASEPSPADDASSQANWAQTYPEPDF

Flanking regions ( +/- flanking 50bp)

GGGTAGAAGCAACTGTGTGCACAGAGTTCAACTAAGACGAGGAGAACATCATGAAAAACCAAGTAACACTCATAGGCTACGTTGGCTCTGAGCCAGAGACGCGAGCCTATCCATCAGGTGATTTGGTGACCAGCATTTCGCTGGCCACTTCTGAGAAATGGCGCGACCGTCAATCCAATGAGCTCAAAGAGCATACGGAATGGCATCGGGTTGTTTTTCGAGATCGTGGTGGATTTAAGTTAGGGCTAAGGGCAAAAGATTTGATCCAAAAAGGAGCGAAGCTTTTTGTTCAAGGGCCCCAGCGCACGCGCTCATGGGAGAAAGATGGCATTAAGCATCGATTGACCGAAGTGGACGCGGACGAGTTTCTGCTTCTTGATAGTGTGAATAAAGCATCTGAGCCATCACCGGCGGATGATGCGAGCTCCCAAGCTAATTGGGCACAAACTTATCCTGAACCAGATTTTTAACCGAGCAAAAATGCTTTAACCCAGCCGGGAGTACTTTCCCGTCAGGGGCA