Homologs in group_38

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00315 FBDBKF_00315 100.0 Morganella morganii S1 - Single-stranded DNA-binding protein
FBDBKF_17025 FBDBKF_17025 77.6 Morganella morganii S1 ssb Single-stranded DNA-binding protein
EHELCC_01230 EHELCC_01230 100.0 Morganella morganii S2 - Single-stranded DNA-binding protein
EHELCC_16565 EHELCC_16565 77.6 Morganella morganii S2 ssb Single-stranded DNA-binding protein
NLDBIP_02230 NLDBIP_02230 100.0 Morganella morganii S4 - Single-stranded DNA-binding protein
NLDBIP_16775 NLDBIP_16775 77.6 Morganella morganii S4 ssb Single-stranded DNA-binding protein
LHKJJB_03745 LHKJJB_03745 100.0 Morganella morganii S3 - Single-stranded DNA-binding protein
LHKJJB_16695 LHKJJB_16695 77.6 Morganella morganii S3 ssb Single-stranded DNA-binding protein
HKOGLL_17660 HKOGLL_17660 77.6 Morganella morganii S5 ssb Single-stranded DNA-binding protein
F4V73_RS18505 F4V73_RS18505 77.8 Morganella psychrotolerans - single-stranded DNA-binding protein
PMI_RS04420 PMI_RS04420 67.1 Proteus mirabilis HI4320 ssb single-stranded DNA-binding protein
PMI_RS12105 PMI_RS12105 38.1 Proteus mirabilis HI4320 ssb single-stranded DNA-binding protein
PMI_RS13540 PMI_RS13540 79.6 Proteus mirabilis HI4320 ssb1 single-stranded DNA-binding protein SSB1

Distribution of the homologs in the orthogroup group_38

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_38

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P28046 2.43e-79 235 68 2 175 1 ssb Single-stranded DNA-binding protein Proteus mirabilis
P25762 6e-75 224 65 3 178 1 ssb Single-stranded DNA-binding protein Serratia marcescens
P0AGE3 2e-74 223 62 2 180 3 ssb Single-stranded DNA-binding protein Shigella flexneri
P0AGE0 2e-74 223 62 2 180 1 ssb Single-stranded DNA-binding protein Escherichia coli (strain K12)
P0AGE1 2e-74 223 62 2 180 3 ssb Single-stranded DNA-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGE2 2e-74 223 62 2 180 3 ssb Single-stranded DNA-binding protein Escherichia coli O157:H7
Q9KUW2 1.39e-70 213 63 4 177 3 ssb Single-stranded DNA-binding protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ZJ06 4.65e-68 207 60 1 182 3 ssb Single-stranded DNA-binding protein Yersinia pestis
Q8D254 6.78e-68 206 60 1 163 3 ssb Single-stranded DNA-binding protein Wigglesworthia glossinidia brevipalpis
P0A2F6 1.18e-67 206 60 4 178 1 ssb Single-stranded DNA-binding protein 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2F7 1.18e-67 206 60 4 178 3 ssb Single-stranded DNA-binding protein 1 Salmonella typhi
Q8K933 1.51e-67 205 59 2 162 3 ssb Single-stranded DNA-binding protein Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57610 1.34e-66 202 56 2 171 3 ssb Single-stranded DNA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q87LA3 4.23e-66 201 60 3 178 3 ssb Single-stranded DNA-binding protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9RHF4 6.77e-66 201 57 2 167 3 ssb2 Single-stranded DNA-binding protein 2 Salmonella typhi
Q8L2A6 1.57e-65 201 58 4 179 3 ssb Single-stranded DNA-binding protein Proteus vulgaris
Q89A53 2.05e-65 199 58 2 166 3 ssb Single-stranded DNA-binding protein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8DCJ0 1.6e-64 197 57 4 180 3 ssb Single-stranded DNA-binding protein Vibrio vulnificus (strain CMCP6)
Q9XJG4 8.95e-63 192 55 1 162 3 ssb Single-stranded DNA-binding protein Escherichia phage P1
Q93GP7 6.73e-62 191 56 2 172 3 ssb2 Single-stranded DNA-binding protein 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8EA81 4.68e-61 191 69 1 127 3 ssb Single-stranded DNA-binding protein Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P28044 1.97e-58 182 51 4 177 1 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
P40947 1.14e-57 180 56 2 164 1 ssb Single-stranded DNA-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P59927 4.72e-56 176 52 5 174 3 ssb Single-stranded DNA-binding protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P28043 2.75e-55 174 50 5 181 3 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
Q83EP4 1.17e-54 172 53 2 160 1 ssb Single-stranded DNA-binding protein Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P28045 1.35e-53 170 49 3 176 3 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
P59930 3.3e-53 169 51 5 177 3 ssb Single-stranded DNA-binding protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P18022 5.47e-53 168 49 3 176 3 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
P18310 2.15e-52 167 62 2 129 3 ssbF Plasmid-derived single-stranded DNA-binding protein Escherichia coli (strain K12)
Q82S98 3.18e-50 160 50 5 161 3 ssb Single-stranded DNA-binding protein Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q847G1 4.48e-50 160 55 2 152 3 ssb Single-stranded DNA-binding protein Pseudomonas putida
Q889U1 1.36e-49 160 54 2 147 3 ssb Single-stranded DNA-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9CJP4 1.4e-49 159 50 5 168 3 ssb Single-stranded DNA-binding protein Pasteurella multocida (strain Pm70)
Q8YHC2 4.68e-49 158 50 3 164 3 ssb Single-stranded DNA-binding protein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P44409 2.23e-48 156 49 4 169 3 ssb Single-stranded DNA-binding protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P77953 8.46e-48 157 63 3 117 3 ssb Single-stranded DNA-binding protein Shewanella hanedai
Q8G0J1 2.35e-47 154 65 2 113 3 ssb Single-stranded DNA-binding protein Brucella suis biovar 1 (strain 1330)
Q8VMM4 3.42e-47 154 60 1 114 3 ssb Single-stranded DNA-binding protein Pseudomonas putida
Q88QK5 7.99e-47 153 61 1 111 3 ssb Single-stranded DNA-binding protein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0C118 1.77e-46 152 64 2 113 3 ssb Single-stranded DNA-binding protein Brucella abortus biovar 1 (strain 9-941)
Q2YPX7 1.77e-46 152 64 2 113 3 ssb Single-stranded DNA-binding protein Brucella abortus (strain 2308)
Q98M41 1.87e-46 152 66 2 113 3 ssb Single-stranded DNA-binding protein Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9A894 1.85e-45 149 52 5 165 3 ssb Single-stranded DNA-binding protein Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q92G30 6.88e-45 147 46 3 151 3 ssb Single-stranded DNA-binding protein Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q89L50 2.98e-44 145 51 4 160 3 ssb Single-stranded DNA-binding protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9ZCC2 5.72e-44 145 45 3 151 3 ssb Single-stranded DNA-binding protein Rickettsia prowazekii (strain Madrid E)
P56898 6.72e-44 145 47 3 170 3 ssb Single-stranded DNA-binding protein Rhizobium meliloti (strain 1021)
Q9ZAQ8 7.19e-44 145 65 2 110 3 ssb Single-stranded DNA-binding protein Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q4UJW3 1.56e-43 144 45 3 151 3 ssb Single-stranded DNA-binding protein Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q68Y11 1.76e-43 143 45 3 151 3 ssb Single-stranded DNA-binding protein Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P59928 2.2e-43 144 59 3 114 3 ssb Single-stranded DNA-binding protein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P66846 2.49e-43 144 59 3 114 3 ssb Single-stranded DNA-binding protein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P66847 2.49e-43 144 59 3 114 3 ssb Single-stranded DNA-binding protein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8UF87 3.22e-42 141 66 1 100 3 ssb Single-stranded DNA-binding protein Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8KB47 4.77e-42 140 46 6 165 3 ssb1 Single-stranded DNA-binding protein 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8Y2B4 1.11e-41 140 56 3 116 3 ssb Single-stranded DNA-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1RK72 2.59e-41 138 44 4 154 3 ssb Single-stranded DNA-binding protein Rickettsia bellii (strain RML369-C)
P66849 4.15e-41 138 42 4 176 3 ssb Single-stranded DNA-binding protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66848 4.15e-41 138 42 4 176 3 ssb Single-stranded DNA-binding protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9PHE7 1.95e-38 130 47 2 120 3 ssb1 Single-stranded DNA-binding protein 1 Xylella fastidiosa (strain 9a5c)
Q9PDI7 3.64e-37 128 42 5 169 3 ssb2 Single-stranded DNA-binding protein 2 Xylella fastidiosa (strain 9a5c)
Q87DQ5 5.21e-37 127 42 5 169 3 ssb Single-stranded DNA-binding protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8P778 1.52e-36 126 53 2 111 3 ssb Single-stranded DNA-binding protein Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PIJ2 1.58e-36 127 53 2 111 3 ssb Single-stranded DNA-binding protein Xanthomonas axonopodis pv. citri (strain 306)
Q8A7M7 2.67e-31 113 44 4 129 3 ssb Single-stranded DNA-binding protein Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P59933 1.37e-24 95 37 5 164 3 ssb Single-stranded DNA-binding protein Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P59931 1.4e-23 93 37 7 172 3 ssb Single-stranded DNA-binding protein Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9WZ73 9.76e-23 90 43 1 100 1 ssb Single-stranded DNA-binding protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6GF73 5.64e-22 89 38 7 162 3 ssb Single-stranded DNA-binding protein Staphylococcus aureus (strain MRSA252)
Q931K4 8.67e-22 88 37 7 162 3 ssb Single-stranded DNA-binding protein 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q99SQ9 1.01e-21 88 37 7 162 3 ssb Single-stranded DNA-binding protein Staphylococcus aureus (strain N315)
Q8NVN2 1.39e-21 88 37 6 162 3 ssb Single-stranded DNA-binding protein Staphylococcus aureus (strain MW2)
Q6G7V6 1.39e-21 88 37 6 162 3 ssb1 Single-stranded DNA-binding protein 1 Staphylococcus aureus (strain MSSA476)
O69302 5.44e-21 87 41 3 119 3 ssb Single-stranded DNA-binding protein Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P66855 1.98e-20 85 34 6 161 3 ssb Single-stranded DNA-binding protein Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P66854 1.98e-20 85 34 6 161 1 ssb Single-stranded DNA-binding protein Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P66851 2.02e-20 85 33 5 168 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66850 2.02e-20 85 33 5 168 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus agalactiae serotype III (strain NEM316)
Q8XH44 5.11e-20 84 34 5 158 3 ssb Single-stranded DNA-binding protein Clostridium perfringens (strain 13 / Type A)
Q92FK7 1.04e-19 83 32 6 164 3 ssb2 Single-stranded DNA-binding protein 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8E0Z9 1.14e-19 82 35 6 156 3 ssb3 Single-stranded DNA-binding protein 3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q5RDQ0 1.15e-19 82 36 2 111 2 SSBP1 Single-stranded DNA-binding protein, mitochondrial Pongo abelii
Q04837 1.57e-19 82 36 2 111 1 SSBP1 Single-stranded DNA-binding protein, mitochondrial Homo sapiens
Q95KK4 1.91e-19 82 37 2 108 2 SSBP1 Single-stranded DNA-binding protein, mitochondrial Oryctolagus cuniculus
Q55499 2.98e-19 80 34 2 128 3 ssb Single-stranded DNA-binding protein 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P37455 5.26e-19 81 32 6 175 1 ssbA Single-stranded DNA-binding protein A Bacillus subtilis (strain 168)
Q839Y9 6.64e-19 82 33 3 136 3 ssb Single-stranded DNA-binding protein Enterococcus faecalis (strain ATCC 700802 / V583)
Q9CDM9 8.71e-19 80 33 8 171 3 ssb2 Single-stranded DNA-binding protein 2 Lactococcus lactis subsp. lactis (strain IL1403)
Q8CX55 1.51e-18 80 30 4 166 3 ssb Single-stranded DNA-binding protein Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q814G6 1.53e-18 80 37 2 114 3 ssb Single-stranded DNA-binding protein Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P59932 1.66e-18 80 38 4 113 3 ssb Single-stranded DNA-binding protein Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P28042 1.85e-18 79 36 2 108 1 Ssbp1 Single-stranded DNA-binding protein, mitochondrial Rattus norvegicus
Q9CYR0 1.91e-18 79 34 2 118 1 Ssbp1 Single-stranded DNA-binding protein, mitochondrial Mus musculus
Q81JI3 2e-18 80 37 2 114 3 ssb Single-stranded DNA-binding protein Bacillus anthracis
B8A5I7 2.41e-18 79 35 2 108 1 ssbp1 Single-stranded DNA-binding protein, mitochondrial Danio rerio
O25841 2.62e-18 80 46 1 89 1 ssb Single-stranded DNA-binding protein Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJY2 2.65e-18 80 45 1 90 3 ssb Single-stranded DNA-binding protein Helicobacter pylori (strain J99 / ATCC 700824)
Q8R6M2 3.18e-18 79 34 4 157 3 ssb Single-stranded DNA-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q32PB0 4.01e-18 79 36 2 111 2 SSBP1 Single-stranded DNA-binding protein, mitochondrial Bos taurus
Q8GAN5 8.07e-18 78 35 3 134 3 ssb Single-stranded DNA-binding protein Paenarthrobacter nicotinovorans
Q8NZJ0 1.08e-17 78 32 6 168 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q8Y4X1 1.39e-17 77 33 4 136 3 ssb2 Single-stranded DNA-binding protein 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9K5N9 1.85e-17 77 36 2 113 3 ssb Single-stranded DNA-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8DSD8 2.03e-17 77 33 6 169 3 ssb Single-stranded DNA-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P0DF77 2.09e-17 77 32 6 168 3 ssb Single-stranded DNA-binding protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DF76 2.09e-17 77 32 6 168 3 ssb Single-stranded DNA-binding protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66852 2.09e-17 77 32 6 168 3 ssb3 Single-stranded DNA-binding protein Streptococcus pyogenes serotype M1
Q5XA62 2.09e-17 77 32 6 168 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8DXI7 2.5e-17 76 34 5 150 3 ssb4 Single-stranded DNA-binding protein 4 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q97CX3 2.91e-17 76 35 6 154 3 ssb3 Single-stranded DNA-binding protein 3 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P09380 3.26e-17 76 34 2 112 1 ssbp1-a Single-stranded DNA-binding protein 1-A, mitochondrial Xenopus laevis
Q928X8 3.75e-17 76 29 3 165 3 ssb3 Single-stranded DNA-binding protein 3 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9CGS5 5.55e-17 75 33 6 155 3 ssb1 Single-stranded DNA-binding protein 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q8KSB6 7.24e-17 76 35 2 114 3 ssb Single-stranded DNA-binding protein Paenarthrobacter aurescens
Q6GCA6 7.95e-17 75 36 3 113 3 ssb2 Single-stranded DNA-binding protein 2 Staphylococcus aureus (strain MSSA476)
Q5HIS8 7.95e-17 75 36 3 113 3 ssb Single-stranded DNA-binding protein 1 Staphylococcus aureus (strain COL)
Q8DIU1 1e-16 74 34 3 124 3 ssb Single-stranded DNA-binding protein Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8YAR8 1.74e-16 75 35 2 111 3 ssb1 Single-stranded DNA-binding protein 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92FR5 1.78e-16 75 35 2 111 3 ssb1 Single-stranded DNA-binding protein 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P09381 1.87e-16 74 34 2 112 1 ssbp1-b Single-stranded DNA-binding protein 1-B, mitochondrial Xenopus laevis
Q9AFI5 2.94e-16 74 34 2 114 1 ssb Single-stranded DNA-binding protein Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8P2H3 5.35e-16 72 35 3 123 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q899R2 1.33e-15 72 39 2 101 3 ssb Single-stranded DNA-binding protein Clostridium tetani (strain Massachusetts / E88)
P9WGD5 1.4e-15 72 32 2 114 1 ssb Single-stranded DNA-binding protein Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGD4 1.4e-15 72 32 2 114 3 ssb Single-stranded DNA-binding protein Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A611 1.4e-15 72 32 2 114 3 ssb Single-stranded DNA-binding protein Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q97HT8 1.62e-15 71 38 2 99 3 ssb2 Single-stranded DNA-binding protein 2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q932A8 1.89e-15 71 37 3 108 3 ssb-p Single-stranded DNA-binding protein 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q9PPT7 2.6e-15 72 30 3 165 3 ssb Single-stranded DNA-binding protein Ureaplasma parvum serovar 3 (strain ATCC 700970)
P46390 5.28e-15 71 32 2 114 1 ssb Single-stranded DNA-binding protein Mycobacterium leprae (strain TN)
Q5HJ26 5.85e-15 70 37 3 108 3 ssb-p Single-stranded DNA-binding protein 2 Staphylococcus aureus (strain COL)
C0SPB6 8.7e-15 69 34 2 99 1 ssbB Single-stranded DNA-binding protein B Bacillus subtilis (strain 168)
Q5XE77 1.51e-14 69 33 6 148 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8ZSD2 3.99e-14 67 32 3 109 3 ssb2 Single-stranded DNA-binding protein 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O83101 5.93e-14 68 36 2 97 3 ssb Single-stranded DNA-binding protein Treponema pallidum (strain Nichols)
P0A4K1 1.13e-13 66 35 2 98 3 ssb1 Single-stranded DNA-binding protein Anabaena variabilis
P0A4K0 1.13e-13 66 35 2 98 3 ssb1 Single-stranded DNA-binding protein 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q97KH4 1.98e-13 65 36 4 109 3 ssb1 Single-stranded DNA-binding protein 1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P54622 2.03e-13 66 33 3 103 1 mtSSB Single-stranded DNA-binding protein, mitochondrial Drosophila melanogaster
Q9KH06 2.12e-13 68 35 1 88 1 ssb Single-stranded DNA-binding protein Thermus aquaticus
Q9KH06 2.81e-07 51 30 5 153 1 ssb Single-stranded DNA-binding protein Thermus aquaticus
Q890K1 6.32e-13 66 37 2 89 3 ssb Single-stranded DNA-binding protein Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
O51141 6.38e-13 65 30 4 151 3 ssb Single-stranded DNA-binding protein Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q5SLP9 8.97e-13 67 33 2 100 1 ssb Single-stranded DNA-binding protein Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5SLP9 3.71e-09 57 35 3 97 1 ssb Single-stranded DNA-binding protein Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q8KAM2 1.08e-12 64 36 4 114 3 ssb2 Single-stranded DNA-binding protein 2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
O85824 1.9e-12 66 33 2 100 3 ssb Single-stranded DNA-binding protein Thermus thermophilus
O85824 3.01e-09 57 35 3 97 3 ssb Single-stranded DNA-binding protein Thermus thermophilus
O66475 2.66e-12 63 36 1 87 3 ssb Single-stranded DNA-binding protein Aquifex aeolicus (strain VF5)
Q9RY51 3.03e-12 65 26 6 182 1 ssb Single-stranded DNA-binding protein Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9RY51 5.97e-10 59 31 3 130 1 ssb Single-stranded DNA-binding protein Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8E220 4.82e-12 62 36 4 110 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7H6 7.28e-12 62 35 4 111 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus agalactiae serotype III (strain NEM316)
Q8RE26 1.33e-11 62 33 3 99 3 ssb Single-stranded DNA-binding protein Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9X8U3 1.74e-11 62 30 2 114 1 ssb2 Single-stranded DNA-binding protein 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8F052 2.05e-11 60 34 1 100 3 ssb Single-stranded DNA-binding protein Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72UU3 2.05e-11 60 34 1 100 3 ssb Single-stranded DNA-binding protein Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8EWT6 3.19e-11 61 30 3 136 3 ssb Single-stranded DNA-binding protein Malacoplasma penetrans (strain HF-2)
Q83N34 3.52e-11 61 30 2 112 3 ssb1 Single-stranded DNA-binding protein 1 Tropheryma whipplei (strain Twist)
Q83NU2 3.52e-11 61 30 2 112 3 ssb1 Single-stranded DNA-binding protein 1 Tropheryma whipplei (strain TW08/27)
Q82FG5 4.46e-11 61 32 2 109 3 ssb1 Single-stranded DNA-binding protein 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q84J78 5.14e-11 61 33 3 114 2 At4g11060 Single-stranded DNA-binding protein, mitochondrial Arabidopsis thaliana
Q8CNK0 2.51e-10 58 26 4 116 3 ssb Single-stranded DNA-binding protein Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P60471 2.57e-10 57 34 2 102 3 ssb Single-stranded DNA-binding protein Onion yellows phytoplasma (strain OY-M)
Q8G757 1.46e-09 57 31 2 109 3 ssb Single-stranded DNA-binding protein Bifidobacterium longum (strain NCC 2705)
Q8NLG0 2.1e-09 57 30 2 110 3 ssb Single-stranded DNA-binding protein Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8FLP9 3.29e-09 57 29 2 111 3 ssb Single-stranded DNA-binding protein Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P34496 6.31e-09 55 37 2 90 1 mtss-1 Single-stranded DNA-binding protein, mitochondrial Caenorhabditis elegans
P75542 0.000131 43 29 4 104 3 ssb Single-stranded DNA-binding protein Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P73145 0.000423 41 24 3 149 1 slr1034 Thylakoid-associated single-stranded DNA-binding protein slr1034 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03300
Feature type CDS
Gene -
Product Single-stranded DNA-binding protein
Location 265519 - 265983 (strand: -1)
Length 465 (nucleotides) / 154 (amino acids)

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_38
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF00436 Single-strand binding protein family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0629 Replication, recombination and repair (L) L Single-stranded DNA-binding protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03111 single-strand DNA-binding protein DNA replication
Mismatch repair
Homologous recombination
-

Protein Sequence

MASRGVNKVILIGNLGQDPEVKFLQSNSAVANFTLATSESWRDKQSGEMKEKTEWHRVVVFGKLAEVAGQYLKKGSQVYIEGQLQTRKWQDQQGQDRYSTEVVVNVGGSIQMLSGRNSGNDNAPAAGSQKPQQQRTQTQNHCEPPMDFDDDIPF

Flanking regions ( +/- flanking 50bp)

AGGTGTATGAGTCACGCAAGGAAGAATTAATCAGCAAAGAGGCGGCATAAATGGCGAGTAGAGGCGTTAATAAAGTCATTCTTATCGGGAACCTCGGACAAGACCCGGAAGTTAAGTTTCTGCAAAGCAATAGTGCGGTGGCTAATTTCACTCTGGCGACAAGCGAATCATGGAGAGATAAGCAGTCAGGTGAAATGAAAGAAAAAACCGAATGGCACAGGGTCGTGGTGTTCGGGAAGCTGGCTGAAGTTGCCGGGCAATACCTGAAAAAAGGAAGTCAGGTATACATCGAAGGTCAGTTGCAGACACGGAAGTGGCAAGACCAGCAGGGGCAAGATCGCTACAGCACGGAGGTTGTTGTGAATGTCGGCGGGTCAATACAAATGCTCAGTGGGCGTAACTCAGGGAATGATAACGCGCCAGCGGCAGGGAGCCAGAAACCACAGCAGCAACGGACGCAGACACAGAATCACTGCGAGCCGCCAATGGATTTTGACGACGACATTCCGTTTTAATAACCCCACCGTTTCAGAATGAAGCGTAATGCAGGGATGCTGAGATAAGG