Homologs in group_3753
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| FBDBKF_12410 | FBDBKF_12410 | 37.5 | Morganella morganii S1 | - | Helix-turn-helix domain-containing protein |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P76063 | 7.78e-08 | 48 | 41 | 0 | 60 | 3 | ydaS | Uncharacterized protein YdaS | Escherichia coli (strain K12) |
| P75975 | 0.000456 | 38 | 41 | 2 | 55 | 4 | croE | Prophage transcriptional regulatory protein | Escherichia coli (strain K12) |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS11990 |
| Feature type | CDS |
| Gene | - |
| Product | helix-turn-helix domain-containing protein |
| Location | 2652110 - 2652361 (strand: 1) |
| Length | 252 (nucleotides) / 83 (amino acids) |
| In genomic island | GI59 |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3753 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
MEVFNTTQKHLRRAIDLVGGQSALARAINSKQQNVWFWLNKSGRVPAEFVLPIEQATQGQVTRSQLRPDIYPECPSELKASNQ
AAACTGTAACATTCAATCTTGTAACAGTTATTATTGTAACAGGAGACGGTATGGAAGTGTTCAACACGACACAAAAACATCTCCGCCGTGCCATTGACTTGGTCGGCGGGCAATCAGCATTAGCACGAGCCATCAACTCAAAACAGCAAAACGTCTGGTTTTGGTTGAATAAATCAGGGCGTGTTCCCGCTGAATTCGTTTTACCCATCGAACAAGCTACGCAAGGACAGGTAACCCGATCCCAGTTAAGACCGGACATCTATCCCGAATGCCCAAGCGAGCTGAAAGCCAGTAACCAGTAGGATTAAGGGCAAATAATGGTCAGCATTTTACGTAAACACAAAAGCGAGTT
