Homologs in group_1144

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06115 FBDBKF_06115 77.4 Morganella morganii S1 tcdA tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
EHELCC_09160 EHELCC_09160 77.4 Morganella morganii S2 tcdA tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
NLDBIP_09540 NLDBIP_09540 77.4 Morganella morganii S4 tcdA tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
LHKJJB_08215 LHKJJB_08215 77.4 Morganella morganii S3 tcdA tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
HKOGLL_07765 HKOGLL_07765 77.4 Morganella morganii S5 tcdA tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
F4V73_RS15800 F4V73_RS15800 78.1 Morganella psychrotolerans tcdA tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA

Distribution of the homologs in the orthogroup group_1144

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1144

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q46927 4.77e-157 441 78 0 266 1 tcdA tRNA threonylcarbamoyladenosine dehydratase Escherichia coli (strain K12)
Q57097 1.63e-106 312 57 3 258 3 tcdA tRNA threonylcarbamoyladenosine dehydratase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O32037 5.99e-42 147 41 1 207 3 tcdA tRNA threonylcarbamoyladenosine dehydratase Bacillus subtilis (strain 168)
O13861 6.75e-24 103 32 1 191 3 SPAC1A6.10 tRNA threonylcarbamoyladenosine dehydratase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P36101 9.16e-21 94 34 3 192 1 TCD2 tRNA threonylcarbamoyladenosine dehydratase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P38756 1.36e-20 94 28 3 194 1 TCD1 tRNA threonylcarbamoyladenosine dehydratase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P30138 3.52e-17 82 33 3 143 1 thiF Sulfur carrier protein ThiS adenylyltransferase Escherichia coli (strain K12)
P12282 1.62e-15 77 33 2 131 1 moeB Molybdopterin-synthase adenylyltransferase Escherichia coli (strain K12)
B4N7R4 2.03e-15 79 29 2 153 3 Uba4 Adenylyltransferase and sulfurtransferase MOCS3 Drosophila willistoni
P45211 2.28e-15 77 32 2 131 3 moeB Molybdopterin-synthase adenylyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O42939 1.07e-13 74 30 3 156 1 uba2 Ubiquitin-activating enzyme E1-like Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q7SXG4 2.63e-13 73 33 3 135 1 uba2 SUMO-activating enzyme subunit 2 Danio rerio
B4NXF7 8.46e-13 71 29 1 132 3 Uba4 Adenylyltransferase and sulfurtransferase MOCS3 Drosophila yakuba
Q28GH3 8.72e-13 71 32 1 133 2 uba2 SUMO-activating enzyme subunit 2 Xenopus tropicalis
Q9Z1F9 1.13e-12 71 31 1 133 1 Uba2 SUMO-activating enzyme subunit 2 Mus musculus
B4LRB9 1.41e-12 70 27 2 141 3 Uba4 Adenylyltransferase and sulfurtransferase MOCS3 Drosophila virilis
P51335 1.54e-12 70 36 2 114 3 moeB Probable molybdopterin-synthase adenylyltransferase Porphyra purpurea
Q9VLJ8 1.55e-12 70 28 1 132 1 Uba4 Adenylyltransferase and sulfurtransferase MOCS3 Drosophila melanogaster
Q9UBT2 2.41e-12 70 31 1 130 1 UBA2 SUMO-activating enzyme subunit 2 Homo sapiens
Q17CA7 4.76e-12 69 30 2 151 3 AAEL004607 Adenylyltransferase and sulfurtransferase MOCS3 Aedes aegypti
Q642Q1 5.5e-12 69 30 1 133 2 uba2-a SUMO-activating enzyme subunit 2-A Xenopus laevis
Q7ZY60 6.56e-12 68 30 1 133 2 uba2-b SUMO-activating enzyme subunit 2-B Xenopus laevis
A5DSR2 8.5e-12 68 40 2 115 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
B4GKQ3 1.19e-11 68 27 2 152 3 Uba4 Adenylyltransferase and sulfurtransferase MOCS3 Drosophila persimilis
B5DS72 1.22e-11 68 27 2 152 3 GA24966 Adenylyltransferase and sulfurtransferase MOCS3-1 Drosophila pseudoobscura pseudoobscura
Q29PG5 1.29e-11 67 27 2 152 3 GA12041 Adenylyltransferase and sulfurtransferase MOCS3-2 Drosophila pseudoobscura pseudoobscura
B4HYP0 1.44e-11 67 28 1 132 3 Uba4 Adenylyltransferase and sulfurtransferase MOCS3 Drosophila sechellia
B3MLX7 1.65e-11 67 28 1 132 3 Uba4 Adenylyltransferase and sulfurtransferase MOCS3 Drosophila ananassae
B4JBC4 2.73e-11 67 31 1 119 3 Uba4 Adenylyltransferase and sulfurtransferase MOCS3 Drosophila grimshawi
B4KI53 2.93e-11 67 26 2 150 3 Uba4 Adenylyltransferase and sulfurtransferase MOCS3 Drosophila mojavensis
Q9SJT1 3e-11 67 29 1 140 1 SAE2 SUMO-activating enzyme subunit 2 Arabidopsis thaliana
B0W377 7.83e-11 65 28 2 149 3 CPIJ001621 Adenylyltransferase and sulfurtransferase MOCS3 Culex quinquefasciatus
A7THV5 2.17e-10 64 29 2 155 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17)
Q54L40 2.35e-10 64 28 1 151 3 uba2 SUMO-activating enzyme subunit 2 Dictyostelium discoideum
Q7PY41 2.97e-10 63 30 1 131 3 AGAP001737 Adenylyltransferase and sulfurtransferase MOCS3 Anopheles gambiae
P46048 3.77e-10 62 31 2 155 2 hesA2 Protein HesA, vegetative Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q6BHZ2 7.9e-10 62 32 1 104 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
B6TNK6 1.04e-09 62 30 2 142 2 MOCS3-1 Adenylyltransferase and sulfurtransferase MOCS3-1 Zea mays
Q9NAN1 1.1e-09 62 28 1 132 3 uba-2 SUMO-activating enzyme subunit uba-2 Caenorhabditis elegans
P46049 1.63e-09 60 29 2 155 2 hesA1 Protein HesA, heterocyst Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B4FAT0 1.79e-09 61 30 2 142 2 MOCS3-2 Adenylyltransferase and sulfurtransferase MOCS3-2 Zea mays
Q56067 2.28e-09 60 33 1 107 3 moeB Molybdopterin-synthase adenylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6B908 3.79e-09 60 32 2 122 3 moeB Probable molybdopterin-synthase adenylyltransferase Gracilaria tenuistipitata var. liui
A5DMB6 3.9e-09 60 30 2 141 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
A6ZT19 4.23e-09 60 28 1 131 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Saccharomyces cerevisiae (strain YJM789)
P38820 5.08e-09 60 28 1 131 1 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B5VK45 5.08e-09 60 28 1 131 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Saccharomyces cerevisiae (strain AWRI1631)
B3LSM6 5.08e-09 60 28 1 131 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Saccharomyces cerevisiae (strain RM11-1a)
Q756K6 2.19e-08 58 33 2 115 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
O65041 2.6e-08 58 34 1 101 1 ECR1 NEDD8-activating enzyme E1 catalytic subunit Arabidopsis thaliana
Q9DBK7 2.94e-08 58 26 2 153 1 Uba7 Ubiquitin-like modifier-activating enzyme 7 Mus musculus
A3LQF9 3.59e-08 57 32 1 104 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q7ZVX6 3.89e-08 57 33 1 107 2 uba3 NEDD8-activating enzyme E1 catalytic subunit Danio rerio
O23034 4.08e-08 57 30 4 138 3 At1g05350 Ubiquitin-like modifier-activating enzyme 5 Arabidopsis thaliana
P41226 4.53e-08 57 26 2 153 1 UBA7 Ubiquitin-like modifier-activating enzyme 7 Homo sapiens
P18500 5.35e-08 56 28 1 137 3 hesA Protein HesA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q99MI7 6.66e-08 56 30 1 107 1 Uba3 NEDD8-activating enzyme E1 catalytic subunit Rattus norvegicus
Q8C878 6.66e-08 56 30 1 107 1 Uba3 NEDD8-activating enzyme E1 catalytic subunit Mus musculus
Q0CFD4 7.02e-08 56 30 2 123 3 uba4 Adenylyltransferase and sulfurtransferase uba4 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A4RPM5 8.25e-08 56 27 1 131 3 UBA4 Adenylyltransferase and sulfurtransferase uba4 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q8TBC4 8.3e-08 56 29 1 107 1 UBA3 NEDD8-activating enzyme E1 catalytic subunit Homo sapiens
Q5R4A0 8.53e-08 56 29 1 107 2 UBA3 NEDD8-activating enzyme E1 catalytic subunit Pongo abelii
Q55FS0 1.09e-07 55 31 2 112 3 mocs3 Adenylyltransferase and sulfurtransferase MOCS3 Dictyostelium discoideum
Q54C02 1.2e-07 55 36 2 83 3 uba5 Ubiquitin-like modifier-activating enzyme 5 Dictyostelium discoideum
P20973 1.22e-07 56 25 4 169 1 UBA1 Ubiquitin-activating enzyme E1 1 Triticum aestivum
Q06624 1.27e-07 55 25 1 139 1 AOS1 DNA damage tolerance protein RHC31 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P52495 1.3e-07 56 25 6 181 3 UBA1 Ubiquitin-activating enzyme E1 1 Candida albicans (strain WO-1)
P52495 3.8e-05 48 22 0 87 3 UBA1 Ubiquitin-activating enzyme E1 1 Candida albicans (strain WO-1)
Q6CMC2 1.34e-07 55 31 2 113 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q59WH7 1.4e-07 55 33 1 103 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Candida albicans (strain SC5314 / ATCC MYA-2876)
O31619 1.6e-07 55 29 4 127 3 thiF Sulfur carrier protein ThiS adenylyltransferase Bacillus subtilis (strain 168)
Q6FR35 1.91e-07 55 31 2 118 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
A2R3H4 2.07e-07 55 27 1 111 3 uba4 Adenylyltransferase and sulfurtransferase uba4 Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
O44510 2.35e-07 55 24 1 132 3 moc-3 Adenylyltransferase and sulfurtransferase MOCS3 Caenorhabditis elegans
P46037 2.83e-07 54 29 1 118 3 hesA Protein HesA Leptolyngbya boryana
Q6K6K7 3.83e-07 54 46 1 67 2 Os02g0506500 Ubiquitin-like modifier-activating enzyme 5 Oryza sativa subsp. japonica
O59954 3.95e-07 54 27 1 112 1 uba4 Adenylyltransferase and sulfurtransferase uba4 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9ZNW0 3.98e-07 54 28 2 132 2 MOCS3 Adenylyltransferase and sulfurtransferase MOCS3 Arabidopsis thaliana
A3ACF3 5.9e-07 53 42 0 66 3 MOCS3 Adenylyltransferase and sulfurtransferase MOCS3 Oryza sativa subsp. japonica
P31251 7.44e-07 53 24 4 169 2 UBA2 Ubiquitin-activating enzyme E1 2 Triticum aestivum
Q72J02 7.97e-07 52 32 1 94 1 ttuC Sulfur carrier protein adenylyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A1CAZ7 8.32e-07 53 28 1 111 3 uba4 Adenylyltransferase and sulfurtransferase uba4 Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
A8WRE3 1.11e-06 52 28 3 121 3 uba-4 Adenylyltransferase and sulfurtransferase MOCS3 Caenorhabditis briggsae
Q2TWN3 1.12e-06 53 27 1 104 3 uba4 Adenylyltransferase and sulfurtransferase uba4 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q6CBK1 1.77e-06 52 39 3 99 3 UBA4 Adenylyltransferase and sulfurtransferase UBA4 Yarrowia lipolytica (strain CLIB 122 / E 150)
P9WMN7 1.84e-06 52 29 3 105 1 moeZ Probable adenylyltransferase/sulfurtransferase MoeZ Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMN6 1.84e-06 52 29 3 105 3 moeZ Probable adenylyltransferase/sulfurtransferase MoeZ Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P22515 1.86e-06 52 26 5 155 1 UBA1 Ubiquitin-activating enzyme E1 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8AWD2 2.16e-06 52 31 4 136 2 mocs3 Adenylyltransferase and sulfurtransferase MOCS3 Danio rerio
Q9V6U8 2.3e-06 52 26 3 141 1 Uba3 Nedd8-activating enzyme E1 catalytic subunit Drosophila melanogaster
P55586 4.3e-06 51 33 5 145 4 NGR_a02280 Uncharacterized protein y4oA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q19360 5.44e-06 50 30 1 112 1 rfl-1 NEDD8-activating enzyme E1 catalytic subunit Caenorhabditis elegans
P52488 7.64e-06 50 20 0 147 1 UBA2 Ubiquitin-activating enzyme E1-like Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q09765 8.62e-06 50 28 3 131 1 uba3 NEDD8-activating enzyme E1 catalytic subunit Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q09810 1.3e-05 49 30 3 119 3 uba4 Adenylyltransferase and sulfurtransferase uba4 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q1XDF1 1.47e-05 49 32 2 125 3 moeB Probable molybdopterin-synthase adenylyltransferase Neopyropia yezoensis
Q55C16 1.82e-05 49 24 4 177 3 uba1 Ubiquitin-like modifier-activating enzyme 1 Dictyostelium discoideum
Q4WV19 1.94e-05 49 27 1 111 3 uba4 Adenylyltransferase and sulfurtransferase uba4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0Y0P7 2.14e-05 49 27 1 111 3 uba4 Adenylyltransferase and sulfurtransferase uba4 Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
Q58E95 2.41e-05 48 28 1 112 2 mocs3 Adenylyltransferase and sulfurtransferase MOCS3 Xenopus laevis
O94609 3.14e-05 48 24 5 178 1 ptr3 Ubiquitin-activating enzyme E1 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O94609 0.000135 47 23 2 111 1 ptr3 Ubiquitin-activating enzyme E1 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A3KMV5 4.65e-05 48 25 3 154 2 UBA1 Ubiquitin-like modifier-activating enzyme 1 Bos taurus
P31252 5.97e-05 48 23 2 156 1 UBA3 Ubiquitin-activating enzyme E1 3 Triticum aestivum
P22314 7.54e-05 47 25 3 154 1 UBA1 Ubiquitin-like modifier-activating enzyme 1 Homo sapiens
Q8C7R4 7.73e-05 47 23 3 176 1 Uba6 Ubiquitin-like modifier-activating enzyme 6 Mus musculus
Q02053 0.000108 47 24 3 154 1 Uba1 Ubiquitin-like modifier-activating enzyme 1 Mus musculus
Q5ZIE6 0.000186 46 23 2 118 2 NAE1 NEDD8-activating enzyme E1 regulatory subunit Gallus gallus
Q99344 0.000207 45 27 3 105 1 UBA3 NEDD8-activating enzyme E1 catalytic subunit Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q28DS0 0.000249 45 26 1 117 2 sae1 SUMO-activating enzyme subunit 1 Xenopus tropicalis
Q8JGT5 0.000254 45 27 1 101 2 sae1 SUMO-activating enzyme subunit 1 Xenopus laevis
Q54QG9 0.000259 45 38 0 71 1 uba3 NEDD8-activating enzyme E1 catalytic subunit Dictyostelium discoideum
O31702 0.000275 45 29 4 141 3 moeB Molybdopterin-synthase adenylyltransferase Bacillus subtilis (strain 168)
Q5U300 0.000277 45 24 3 154 1 Uba1 Ubiquitin-like modifier-activating enzyme 1 Rattus norvegicus
Q29504 0.000287 45 24 2 153 1 UBA1 Ubiquitin-like modifier-activating enzyme 1 Oryctolagus cuniculus
Q6AXQ0 0.000529 44 25 1 108 2 Sae1 SUMO-activating enzyme subunit 1 Rattus norvegicus
A5GFZ6 0.000778 44 27 1 112 3 MOCS3 Adenylyltransferase and sulfurtransferase MOCS3 Sus scrofa

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11380
Feature type CDS
Gene tcdA
Product tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
Location 2504070 - 2504918 (strand: -1)
Length 849 (nucleotides) / 282 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1144
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00899 ThiF family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1179 Translation, ribosomal structure and biogenesis (J) J tRNA A37 threonylcarbamoyladenosine dehydratase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K22132 tRNA threonylcarbamoyladenosine dehydratase - -

Protein Sequence

MQNSLSDSYLQRFSGIGRLYGQQALYYFSQAHICVVGIGGVGSWAAEALARSGIGAITLIDMDDVCVTNTNRQIHALKEHVGQPKCEVMKQRILQINPECKVTCVDDFVTVDNVAEMMQNSFDYVIDAIDSVRPKAALLAYCRRYKIPVITTGGAGGQIDPTQIQVVDLAKTIQDPLAAKLRERLKSDFNVVKNSKGKLGIDCVFSTEQLVYPQGDGTVCAAKSTADGVKRMDCSAGFGAVTMVTASFGFIAVSHVLKKMLAKAQRTRHTSSCRVVDGAQSH

Flanking regions ( +/- flanking 50bp)

TGATTAACAATAGCCATGATTATTTCTGCTATCTAGGTTGTTATCGCATTATGCAAAATTCATTATCAGACTCCTATCTGCAACGCTTTTCTGGTATTGGCCGTCTTTATGGACAACAAGCGCTGTATTATTTTTCTCAGGCACATATTTGTGTTGTCGGCATTGGTGGCGTTGGTAGCTGGGCTGCAGAAGCCTTAGCTCGCAGTGGGATCGGCGCTATTACGTTAATTGATATGGATGATGTGTGTGTCACCAATACCAATCGACAAATTCATGCGCTAAAAGAGCATGTCGGCCAGCCTAAATGTGAAGTGATGAAGCAGCGAATTTTGCAAATTAATCCTGAATGCAAAGTTACTTGTGTTGATGATTTTGTTACGGTTGATAATGTGGCAGAAATGATGCAAAACTCATTTGATTATGTGATTGATGCTATTGATAGTGTTAGACCAAAGGCCGCATTATTAGCTTACTGTCGTCGCTATAAAATTCCTGTTATCACCACTGGTGGCGCAGGCGGACAGATTGATCCAACTCAAATCCAAGTCGTCGATTTAGCGAAAACCATTCAAGATCCATTAGCCGCTAAATTACGTGAGCGTTTAAAATCTGATTTTAATGTTGTGAAAAATAGCAAAGGTAAATTAGGCATAGATTGTGTTTTTTCAACCGAGCAATTAGTCTACCCTCAAGGAGATGGTACGGTGTGTGCGGCCAAAAGTACTGCCGATGGTGTCAAGCGTATGGACTGCTCAGCGGGTTTTGGCGCGGTGACAATGGTTACCGCTTCCTTTGGTTTTATTGCCGTTTCTCATGTATTAAAGAAGATGTTAGCTAAGGCGCAACGTACTCGTCATACTTCAAGTTGTCGCGTTGTTGATGGTGCTCAATCGCACTAGTCACCTAGTTGCACTTTGGAGCATTTAAGCGTATTGATCCACCATACAAC