Homologs in group_1136

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06055 FBDBKF_06055 56.6 Morganella morganii S1 yqcC DUF446 domain-containing protein
EHELCC_09100 EHELCC_09100 56.6 Morganella morganii S2 yqcC DUF446 domain-containing protein
NLDBIP_09480 NLDBIP_09480 56.6 Morganella morganii S4 yqcC DUF446 domain-containing protein
LHKJJB_08275 LHKJJB_08275 56.6 Morganella morganii S3 yqcC DUF446 domain-containing protein
HKOGLL_07825 HKOGLL_07825 56.6 Morganella morganii S5 yqcC DUF446 domain-containing protein
F4V73_RS15850 F4V73_RS15850 53.8 Morganella psychrotolerans - YqcC family protein

Distribution of the homologs in the orthogroup group_1136

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1136

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57152 8.69e-24 90 52 1 85 4 HI_1436 Uncharacterized protein HI_1436 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q46919 2.68e-21 84 51 1 82 1 yqcC Uncharacterized protein YqcC Escherichia coli (strain K12)
Q47417 5.68e-16 74 38 0 89 3 truC tRNA pseudouridine synthase C Pectobacterium carotovorum subsp. carotovorum

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11330
Feature type CDS
Gene -
Product YqcC family protein
Location 2494580 - 2494903 (strand: -1)
Length 324 (nucleotides) / 107 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1136
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04287 tRNA pseudouridine synthase C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3098 Function unknown (S) S Uncharacterized conserved protein YqcC, DUF446 family

Protein Sequence

MTSEQHILARLLLIEEEMKNIGLWQLDAPNDEAFASSEPFCIDTMEAHEWLQWVLIPRLSSLIDSGMALPTAFAIAPYYEEAFKDDETRDYVDLLNHLRELDALFKQ

Flanking regions ( +/- flanking 50bp)

CTTTCAGCCCCAATGTTATGCTTATTCTGTTTTTATGTAAGGAATAAACAATGACCTCAGAACAACACATTTTAGCAAGACTGTTATTAATTGAAGAAGAGATGAAAAACATAGGGTTATGGCAATTGGATGCGCCTAATGATGAGGCTTTTGCAAGCTCAGAGCCTTTTTGTATTGATACAATGGAGGCGCATGAATGGTTGCAATGGGTTCTGATCCCTCGTTTATCTTCTCTTATTGACAGTGGTATGGCATTGCCGACGGCTTTTGCTATCGCACCTTATTATGAAGAAGCATTTAAGGACGATGAGACGCGTGATTATGTGGATTTACTCAATCACCTTCGTGAACTTGATGCGTTATTTAAGCAATAAGGTCAATGATGCTAGATATTATTTATCAAGATGAATATCTTGTGGCGGTG