Homologs in group_1069

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_09100 EHELCC_09100 100.0 Morganella morganii S2 yqcC DUF446 domain-containing protein
NLDBIP_09480 NLDBIP_09480 100.0 Morganella morganii S4 yqcC DUF446 domain-containing protein
LHKJJB_08275 LHKJJB_08275 100.0 Morganella morganii S3 yqcC DUF446 domain-containing protein
HKOGLL_07825 HKOGLL_07825 100.0 Morganella morganii S5 yqcC DUF446 domain-containing protein
F4V73_RS15850 F4V73_RS15850 83.2 Morganella psychrotolerans - YqcC family protein
PMI_RS11330 PMI_RS11330 56.6 Proteus mirabilis HI4320 - YqcC family protein

Distribution of the homologs in the orthogroup group_1069

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1069

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57152 5.62e-24 90 48 0 87 4 HI_1436 Uncharacterized protein HI_1436 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q47417 9.15e-17 77 34 0 96 3 truC tRNA pseudouridine synthase C Pectobacterium carotovorum subsp. carotovorum
Q46919 1.29e-16 72 39 2 107 1 yqcC Uncharacterized protein YqcC Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_06055
Feature type CDS
Gene yqcC
Product DUF446 domain-containing protein
Location 36164 - 36487 (strand: -1)
Length 324 (nucleotides) / 107 (amino acids)

Contig

Accession contig_6
Length 178871 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1069
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04287 tRNA pseudouridine synthase C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3098 Function unknown (S) S Uncharacterized conserved protein YqcC, DUF446 family

Protein Sequence

MTKHQQITAILTDIENEMRAVDLWQGQPPAAEAFESELPFAVDTMNAHEWLQWILIPRLYAMIEQGAALPSAFQIAPYFEEHYRGDEQAARYLVLLDHLRALDGLFA

Flanking regions ( +/- flanking 50bp)

GCGGCATTGGCTGCGGAAAATGAATTTTACAGCGTAAACAGGTTTCAGTTATGACAAAACATCAGCAGATTACTGCGATCCTGACGGACATCGAGAACGAGATGCGCGCCGTCGATCTGTGGCAGGGGCAGCCTCCGGCAGCAGAAGCATTTGAAAGCGAACTGCCGTTTGCGGTGGATACCATGAATGCCCATGAGTGGTTACAGTGGATCCTTATCCCGCGTCTGTATGCCATGATTGAACAGGGCGCGGCACTGCCGTCCGCCTTTCAGATAGCCCCGTATTTTGAAGAGCACTACAGAGGGGACGAACAGGCTGCACGCTATCTGGTGCTGCTTGACCATTTACGGGCACTGGACGGGCTTTTCGCGTGACACAACCATTGCAGGACACGCCATTACCGGAAAAAACATTACCGGAAAAA