Homologs in group_1135

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06050 FBDBKF_06050 73.1 Morganella morganii S1 truC tRNA pseudouridine(65) synthase TruC
EHELCC_09095 EHELCC_09095 73.1 Morganella morganii S2 truC tRNA pseudouridine(65) synthase TruC
NLDBIP_09475 NLDBIP_09475 73.1 Morganella morganii S4 truC tRNA pseudouridine(65) synthase TruC
LHKJJB_08280 LHKJJB_08280 73.1 Morganella morganii S3 truC tRNA pseudouridine(65) synthase TruC
HKOGLL_07830 HKOGLL_07830 73.1 Morganella morganii S5 truC tRNA pseudouridine(65) synthase TruC
F4V73_RS15855 F4V73_RS15855 70.2 Morganella psychrotolerans truC tRNA pseudouridine(65) synthase TruC

Distribution of the homologs in the orthogroup group_1135

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1135

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZH72 1.25e-125 360 70 0 245 3 truC tRNA pseudouridine synthase C Yersinia pestis
Q47417 6.79e-122 355 67 2 261 3 truC tRNA pseudouridine synthase C Pectobacterium carotovorum subsp. carotovorum
Q8X6T6 2.24e-115 334 65 0 245 3 truC tRNA pseudouridine synthase C Escherichia coli O157:H7
P0AA42 2.37e-115 334 65 0 245 3 truC tRNA pseudouridine synthase C Shigella flexneri
P0AA41 2.37e-115 334 65 0 245 1 truC tRNA pseudouridine synthase C Escherichia coli (strain K12)
Q8FEF9 1.16e-114 332 65 0 245 3 truC tRNA pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8Z439 1.95e-111 324 63 0 245 3 truC tRNA pseudouridine synthase C Salmonella typhi
Q8ZMD5 2.03e-111 324 63 0 245 3 truC tRNA pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9KTL4 2.21e-111 323 63 0 237 3 truC tRNA pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87MD4 4.4e-108 315 62 0 235 3 truC tRNA pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DBG5 1.99e-102 300 61 0 236 3 truC tRNA pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
P59840 1.83e-97 288 60 1 235 3 truC tRNA pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CNF3 5.01e-97 287 61 0 235 3 truC tRNA pseudouridine synthase C Pasteurella multocida (strain Pm70)
P44197 7.18e-96 284 58 0 239 3 truC tRNA pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q89AH2 7.86e-27 108 29 3 229 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P44782 4.42e-24 99 32 8 232 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q45826 2.25e-23 99 31 6 245 3 Caur_0901 Uncharacterized RNA pseudouridine synthase Caur_0901 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q9CK02 2.34e-23 97 34 9 222 3 rluA Dual-specificity RNA pseudouridine synthase RluA Pasteurella multocida (strain Pm70)
Q8D8G1 4.06e-23 99 30 6 221 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
P50513 5.4e-23 98 29 4 230 3 rluD Ribosomal large subunit pseudouridine synthase D Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8K9J8 4.83e-22 95 28 5 239 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9HZM9 7.53e-22 95 32 7 233 3 rluC Ribosomal large subunit pseudouridine synthase C Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AA38 8.13e-22 93 32 7 231 3 rluA Dual-specificity RNA pseudouridine synthase RluA Shigella flexneri
P0AA37 8.13e-22 93 32 7 231 1 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli (strain K12)
Q9KQH0 8.49e-22 95 29 5 219 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8FL93 1.54e-21 92 32 7 231 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XA10 1.32e-20 90 32 7 231 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O157:H7
O31613 2.3e-20 90 29 7 244 3 yjbO Uncharacterized RNA pseudouridine synthase YjbO Bacillus subtilis (strain 168)
P54604 5.51e-20 90 28 6 237 3 yhcT Uncharacterized RNA pseudouridine synthase YhcT Bacillus subtilis (strain 168)
Q87N15 7.35e-20 90 28 5 219 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P57430 8.61e-20 89 29 4 230 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8Z9J5 1.09e-19 87 30 5 231 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhi
Q8ZFU1 1.13e-19 89 31 6 237 3 rluC Ribosomal large subunit pseudouridine synthase C Yersinia pestis
Q8ZRV9 1.16e-19 87 30 5 231 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FIP7 1.95e-19 89 30 6 226 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8P682 2.12e-19 89 28 6 242 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PHN2 2.78e-19 88 28 6 240 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas axonopodis pv. citri (strain 306)
Q9KU20 3.71e-19 88 28 7 235 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8X8J3 5.55e-19 87 29 6 231 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O157:H7
P0AA40 5.66e-19 87 29 6 231 3 rluC Ribosomal large subunit pseudouridine synthase C Shigella flexneri
P0AA39 5.66e-19 87 29 6 231 1 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli (strain K12)
Q8K9E9 6.4e-19 87 25 5 234 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q87AR7 8.52e-19 87 30 7 232 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P65835 8.64e-19 87 29 9 245 3 rluD Ribosomal large subunit pseudouridine synthase D Shigella flexneri
P65834 8.64e-19 87 29 9 245 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X9F0 8.73e-19 87 29 9 245 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O157:H7
P70870 1.06e-18 87 30 7 213 3 rluD Ribosomal large subunit pseudouridine synthase D Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8ZBV7 1.22e-18 87 27 8 273 3 rluD Ribosomal large subunit pseudouridine synthase D Yersinia pestis
P33643 1.24e-18 87 29 9 245 1 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli (strain K12)
P75485 1.64e-18 86 29 6 225 3 MPN_292 Uncharacterized RNA pseudouridine synthase MG209 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O25114 2.17e-18 85 30 6 203 1 HP_0347 Uncharacterized RNA pseudouridine synthase HP_0347 Helicobacter pylori (strain ATCC 700392 / 26695)
Q8DCG0 3.04e-18 84 32 8 214 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio vulnificus (strain CMCP6)
P59835 3.58e-18 85 28 6 227 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8ZQ16 4.68e-18 85 29 6 231 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9CKA6 5.36e-18 85 27 6 229 3 rluD Ribosomal large subunit pseudouridine synthase D Pasteurella multocida (strain Pm70)
Q9ZKP5 5.65e-18 83 29 7 208 3 jhp_0890 Uncharacterized RNA pseudouridine synthase jhp_0890 Helicobacter pylori (strain J99 / ATCC 700824)
Q9L7A7 6.48e-18 84 26 7 264 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9PET9 7.33e-18 84 30 5 229 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain 9a5c)
Q9ZMA1 7.68e-18 84 29 5 198 3 jhp_0321 Uncharacterized RNA pseudouridine synthase jhp_0321 Helicobacter pylori (strain J99 / ATCC 700824)
Q8Z7J7 9.89e-18 84 29 6 231 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhi
P44445 1.39e-17 84 26 6 248 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CM51 2e-17 83 28 7 234 3 rluC Ribosomal large subunit pseudouridine synthase C Pasteurella multocida (strain Pm70)
Q87LD3 2.31e-17 82 32 7 211 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8ZIK1 3.69e-17 80 30 9 229 3 rluA Dual-specificity RNA pseudouridine synthase RluA Yersinia pestis
P65836 7.99e-17 81 28 9 245 1 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65837 7.99e-17 81 28 9 245 3 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhi
P33640 1.68e-16 80 27 9 259 3 rluD Ribosomal large subunit pseudouridine synthase D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57481 1.76e-16 80 25 6 239 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O25610 1.89e-16 79 34 5 161 3 HP_0956 Uncharacterized RNA pseudouridine synthase HP_0956 Helicobacter pylori (strain ATCC 700392 / 26695)
Q87S65 2.42e-16 80 27 7 239 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9JVB6 2.57e-16 80 29 9 237 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
O66114 2.71e-16 78 32 10 228 3 ZMO0505 Uncharacterized RNA pseudouridine synthase ZMO0505 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9K0B0 3.06e-16 80 29 9 248 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P72970 3.26e-16 79 32 9 228 3 slr1592 Uncharacterized RNA pseudouridine synthase slr1592 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A5T3 3.58e-16 79 29 7 238 3 BQ2027_MB1567 Uncharacterized RNA pseudouridine synthase Mb1567 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ3 3.58e-16 79 29 7 238 1 Rv1540 Uncharacterized RNA pseudouridine synthase Rv1540 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHQ2 3.58e-16 79 29 7 238 3 MT1592 Uncharacterized RNA pseudouridine synthase MT1592 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O67638 3.63e-16 79 30 6 188 3 aq_1758 Uncharacterized RNA pseudouridine synthase aq_1758 Aquifex aeolicus (strain VF5)
P44433 4.55e-16 79 28 6 230 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P59838 5.38e-16 79 27 8 238 3 rluD Ribosomal large subunit pseudouridine synthase D Blochmanniella floridana
P43930 5.74e-16 77 28 5 211 3 HI_0042 Uncharacterized RNA pseudouridine synthase HI_0042 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q82WZ5 9.15e-16 79 29 6 223 3 rluD Ribosomal large subunit pseudouridine synthase D Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P74346 1.01e-15 78 30 6 228 3 slr1629 Uncharacterized RNA pseudouridine synthase slr1629 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1RJX7 1.01e-15 78 30 7 220 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia bellii (strain RML369-C)
Q4UKQ3 1.09e-15 78 30 7 224 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9KP71 1.26e-15 77 31 9 222 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P47451 1.61e-15 77 26 6 222 3 MG209 Uncharacterized RNA pseudouridine synthase MG209 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8XYX8 2.27e-15 78 29 10 229 3 rluD Ribosomal large subunit pseudouridine synthase D Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q08C69 2.61e-15 77 29 12 243 2 rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Danio rerio
O50310 4.87e-15 76 27 8 240 3 Cpar_0723 Uncharacterized RNA pseudouridine synthase Cpar_0723 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8VCZ8 7.12e-15 76 28 7 220 2 Rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Mus musculus
Q9UJJ7 7.25e-15 76 28 6 219 1 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Homo sapiens
Q17QT4 7.63e-15 75 28 7 240 2 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Bos taurus
Q92IS6 7.86e-15 75 30 7 224 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8DEV0 8.36e-15 76 27 7 235 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio vulnificus (strain CMCP6)
P59831 2.71e-14 73 29 6 225 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P53294 7.08e-14 73 26 4 189 1 PUS6 tRNA pseudouridine(31) synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q68XB2 7.5e-14 73 28 6 225 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZDR7 1.07e-13 72 27 7 229 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia prowazekii (strain Madrid E)
Q7XA65 1.08e-13 72 26 9 250 2 At1g56345 RNA pseudouridine synthase 1 Arabidopsis thaliana
Q9ZL98 1.21e-13 72 27 8 236 3 jhp_0682 Uncharacterized RNA pseudouridine synthase jhp_0682 Helicobacter pylori (strain J99 / ATCC 700824)
Q5M721 2.78e-13 72 26 6 205 2 At3g52260 RNA pseudouridine synthase 5 Arabidopsis thaliana
Q45480 4.29e-13 70 27 6 244 3 ylyB Uncharacterized RNA pseudouridine synthase YlyB Bacillus subtilis (strain 168)
Q12069 7.46e-13 71 27 3 183 1 PUS9 tRNA pseudouridine(32) synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q0DST9 8.6e-13 70 24 7 273 2 Os03g0288500 RNA pseudouridine synthase 5 Oryza sativa subsp. japonica
Q12362 1.05e-12 70 27 3 183 1 RIB2 Bifunctional protein RIB2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O25441 3.31e-12 68 26 8 236 3 HP_0745 Uncharacterized RNA pseudouridine synthase HP_0745 Helicobacter pylori (strain ATCC 700392 / 26695)
Q149F1 4.56e-12 68 29 5 192 1 Rpusd2 Pseudouridylate synthase RPUSD2 Mus musculus
Q9LU60 7.61e-12 68 29 4 180 2 At5g51140 RNA pseudouridine synthase 7 Arabidopsis thaliana
Q6DBR0 1.12e-11 67 29 8 199 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Danio rerio
Q89AD9 2.01e-11 66 26 5 223 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8IZ73 2.09e-11 67 29 4 176 1 RPUSD2 Pseudouridylate synthase RPUSD2 Homo sapiens
Q28C59 2.22e-11 66 28 9 270 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Xenopus tropicalis
Q5E9Z1 5.45e-11 65 29 11 265 2 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Bos taurus
Q09709 6.38e-11 65 28 5 186 3 SPAC18B11.02c Pseudouridylate synthase C18B11.02c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q4QQT0 1.24e-10 64 30 7 195 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Rattus norvegicus
Q96CM3 3.45e-10 63 30 8 196 1 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Homo sapiens
Q2QNM3 7.39e-10 62 22 8 268 2 Os12g0560500 RNA pseudouridine synthase 1 Oryza sativa subsp. japonica
Q3ECD0 8.16e-09 58 26 7 222 2 At1g76050 RNA pseudouridine synthase 2, chloroplastic Arabidopsis thaliana
Q9CWX4 8.39e-09 58 30 7 201 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Mus musculus
Q9LT72 2.92e-08 57 26 7 205 2 At3g19440 RNA pseudouridine synthase 4, mitochondrial Arabidopsis thaliana
Q0E0Y3 3.34e-08 57 27 5 188 2 Os02g0512300 RNA pseudouridine synthase 7 Oryza sativa subsp. japonica
Q5Z8P2 7.47e-08 56 24 7 230 2 Os06g0717400 RNA pseudouridine synthase 2, chloroplastic Oryza sativa subsp. japonica
Q0J4D4 1.46e-07 55 29 9 194 2 Os08g0520100 RNA pseudouridine synthase 3, mitochondrial Oryza sativa subsp. japonica
O16686 2.3e-07 54 29 4 177 3 K07E8.7 Uncharacterized protein K07E8.7 Caenorhabditis elegans
Q69K07 1.68e-06 52 25 5 177 2 Os09g0103500 RNA pseudouridine synthase 4, mitochondrial Oryza sativa subsp. japonica
P47610 2.86e-06 51 22 7 216 3 MG370 Uncharacterized RNA pseudouridine synthase MG370 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75230 1.56e-05 48 22 10 246 3 MPN_548 Uncharacterized RNA pseudouridine synthase MG370 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8I3Z1 3.64e-05 48 34 1 66 1 PFE0570w MATH and LRR domain-containing protein PFE0570w Plasmodium falciparum (isolate 3D7)
O67444 0.000145 45 26 7 171 3 aq_1464 Uncharacterized RNA pseudouridine synthase aq_1464 Aquifex aeolicus (strain VF5)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11325
Feature type CDS
Gene truC
Product tRNA pseudouridine(65) synthase TruC
Location 2493792 - 2494571 (strand: -1)
Length 780 (nucleotides) / 259 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1135
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00849 RNA pseudouridylate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0564 Translation, ribosomal structure and biogenesis (J) J Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06175 tRNA pseudouridine65 synthase [EC:5.4.99.26] - -

Protein Sequence

MLDIIYQDEYLVAVNKPAGWLVHRSWLDRHETVFVMQTLRDQIGQHVFPVHRLDRPTSGVLLMALSSEVARTLSVCFEQHQMEKVYHAVVRGYVEEPMIIDSPLVEEHDKIADKFASQPPKIQHCITHCVPLAKVEKEVAIGRYPTSRFSLLELRPETGRKHQLRRHMSHIRHPIIGDTAHGDLRQNRGVVNHFQSHRLMLHASQLNLIHPITQQPLNLTAKWDLPWQHLINQFGWRGLKPELEQFGEDLAHHFVLSDI

Flanking regions ( +/- flanking 50bp)

CTCAATCACCTTCGTGAACTTGATGCGTTATTTAAGCAATAAGGTCAATGATGCTAGATATTATTTATCAAGATGAATATCTTGTGGCGGTGAATAAACCGGCGGGCTGGCTTGTTCACCGCAGTTGGCTTGATAGGCATGAAACCGTGTTTGTGATGCAAACATTAAGAGATCAAATTGGTCAGCATGTTTTTCCTGTTCATCGTTTAGATAGACCCACATCCGGAGTGCTATTAATGGCGCTCTCTTCCGAGGTTGCAAGAACACTTTCAGTCTGTTTTGAACAACATCAAATGGAGAAAGTGTATCATGCAGTTGTGCGTGGCTATGTTGAAGAGCCAATGATAATTGATAGTCCACTTGTTGAAGAGCATGACAAAATCGCTGACAAATTTGCCTCTCAACCTCCTAAAATTCAACACTGTATTACGCATTGTGTGCCACTTGCAAAAGTGGAAAAAGAAGTGGCGATAGGGCGCTATCCAACATCGCGTTTTAGCTTATTGGAATTACGTCCTGAAACGGGGCGTAAGCATCAATTGCGCCGTCATATGTCTCATATTCGTCACCCTATTATTGGGGATACAGCCCATGGCGATTTACGACAAAATCGTGGGGTCGTAAATCATTTTCAATCACATCGTTTGATGTTACACGCAAGTCAGCTAAACTTAATTCATCCGATCACTCAACAACCACTTAACTTAACAGCGAAGTGGGATCTGCCATGGCAACATCTGATTAATCAGTTTGGCTGGCGTGGTCTAAAGCCCGAATTAGAGCAATTCGGTGAGGATTTAGCTCACCATTTTGTACTTTCTGATATTTGAATATTGCTTACCTGTCGTGACTATCAAGACTTATTTACTTAAGTTTTGAT