Homologs in group_1135

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06050 FBDBKF_06050 100.0 Morganella morganii S1 truC tRNA pseudouridine(65) synthase TruC
EHELCC_09095 EHELCC_09095 100.0 Morganella morganii S2 truC tRNA pseudouridine(65) synthase TruC
LHKJJB_08280 LHKJJB_08280 100.0 Morganella morganii S3 truC tRNA pseudouridine(65) synthase TruC
HKOGLL_07830 HKOGLL_07830 100.0 Morganella morganii S5 truC tRNA pseudouridine(65) synthase TruC
F4V73_RS15855 F4V73_RS15855 87.6 Morganella psychrotolerans truC tRNA pseudouridine(65) synthase TruC
PMI_RS11325 PMI_RS11325 73.1 Proteus mirabilis HI4320 truC tRNA pseudouridine(65) synthase TruC

Distribution of the homologs in the orthogroup group_1135

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1135

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AA42 1.22e-126 362 73 1 236 3 truC tRNA pseudouridine synthase C Shigella flexneri
P0AA41 1.22e-126 362 73 1 236 1 truC tRNA pseudouridine synthase C Escherichia coli (strain K12)
Q8ZH72 1.46e-126 362 72 1 237 3 truC tRNA pseudouridine synthase C Yersinia pestis
Q8X6T6 1.5e-126 362 73 1 236 3 truC tRNA pseudouridine synthase C Escherichia coli O157:H7
Q8FEF9 3.44e-126 361 73 1 236 3 truC tRNA pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q47417 3.09e-121 353 72 1 236 3 truC tRNA pseudouridine synthase C Pectobacterium carotovorum subsp. carotovorum
Q8Z439 3.28e-119 343 70 1 236 3 truC tRNA pseudouridine synthase C Salmonella typhi
Q8ZMD5 7.87e-119 343 70 1 236 3 truC tRNA pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9KTL4 2.29e-117 338 67 1 236 3 truC tRNA pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87MD4 1.46e-113 329 66 1 235 3 truC tRNA pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DBG5 2.73e-109 318 64 1 236 3 truC tRNA pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
P59840 1.28e-103 303 60 0 234 3 truC tRNA pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CNF3 6.03e-103 301 61 1 237 3 truC tRNA pseudouridine synthase C Pasteurella multocida (strain Pm70)
P44197 2.75e-99 292 59 1 236 3 truC tRNA pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AA40 5.15e-31 120 35 6 233 3 rluC Ribosomal large subunit pseudouridine synthase C Shigella flexneri
P0AA39 5.15e-31 120 35 6 233 1 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli (strain K12)
Q8FIP7 6.02e-31 119 35 6 233 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X8J3 1.5e-30 119 35 6 233 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O157:H7
Q8ZQ16 4.53e-30 117 35 6 233 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7J7 5.3e-30 117 35 6 233 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhi
Q9KQH0 1.24e-29 116 33 7 238 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q45826 2.18e-29 115 33 6 256 3 Caur_0901 Uncharacterized RNA pseudouridine synthase Caur_0901 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
P44782 1.54e-28 111 35 8 234 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8P682 4.68e-28 112 33 6 247 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9HZM9 1.13e-27 111 34 9 251 3 rluC Ribosomal large subunit pseudouridine synthase C Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AA38 1.68e-27 108 34 5 228 3 rluA Dual-specificity RNA pseudouridine synthase RluA Shigella flexneri
P0AA37 1.68e-27 108 34 5 228 1 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli (strain K12)
Q8D8G1 2.7e-27 110 30 6 231 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
Q8FL93 3.08e-27 107 34 5 228 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9CK02 1.45e-26 105 35 8 228 3 rluA Dual-specificity RNA pseudouridine synthase RluA Pasteurella multocida (strain Pm70)
Q89AH2 2.54e-26 107 28 4 232 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8XA10 3.04e-26 105 33 6 230 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O157:H7
Q8Z9J5 5.37e-26 104 34 5 229 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhi
Q8ZRV9 5.54e-26 104 34 5 229 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q87N15 1.09e-25 105 30 5 227 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8PHN2 1.12e-25 106 32 6 243 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas axonopodis pv. citri (strain 306)
P50513 1.85e-25 105 29 6 254 3 rluD Ribosomal large subunit pseudouridine synthase D Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9CM51 2.71e-24 102 31 5 229 3 rluC Ribosomal large subunit pseudouridine synthase C Pasteurella multocida (strain Pm70)
P44433 4.12e-24 101 31 9 251 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8X9F0 5.32e-24 101 32 6 240 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O157:H7
P65835 5.49e-24 101 32 6 240 3 rluD Ribosomal large subunit pseudouridine synthase D Shigella flexneri
P65834 5.49e-24 101 32 6 240 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P33643 7.77e-24 100 32 6 240 1 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli (strain K12)
Q8DCG0 9.85e-24 99 34 7 217 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio vulnificus (strain CMCP6)
P44445 1.21e-23 100 29 6 234 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P59831 1.8e-23 97 31 5 228 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P54604 3e-23 99 30 6 234 3 yhcT Uncharacterized RNA pseudouridine synthase YhcT Bacillus subtilis (strain 168)
Q87AR7 4.11e-23 99 32 5 226 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9CKA6 1.01e-22 97 28 6 252 3 rluD Ribosomal large subunit pseudouridine synthase D Pasteurella multocida (strain Pm70)
Q9L7A7 1.02e-22 98 27 6 252 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8ZBV7 1.41e-22 97 30 6 243 3 rluD Ribosomal large subunit pseudouridine synthase D Yersinia pestis
Q8ZFU1 1.54e-22 97 31 6 226 3 rluC Ribosomal large subunit pseudouridine synthase C Yersinia pestis
Q9PET9 2.18e-22 97 32 5 228 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain 9a5c)
Q87LD3 2.27e-22 95 33 6 221 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O31613 3.01e-22 95 31 8 243 3 yjbO Uncharacterized RNA pseudouridine synthase YjbO Bacillus subtilis (strain 168)
P59835 3.35e-22 96 31 7 232 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P57430 3.43e-22 96 29 4 229 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8XYX8 9.59e-22 95 30 8 243 3 rluD Ribosomal large subunit pseudouridine synthase D Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8ZIK1 2.53e-21 91 31 6 219 3 rluA Dual-specificity RNA pseudouridine synthase RluA Yersinia pestis
P65836 2.89e-21 94 31 6 235 1 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65837 2.89e-21 94 31 6 235 3 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhi
Q9KU20 2.96e-21 94 30 6 234 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P70870 3.36e-21 94 31 7 194 3 rluD Ribosomal large subunit pseudouridine synthase D Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q87S65 3.71e-21 93 30 6 234 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9K0B0 5.1e-21 94 30 6 239 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P33640 6.98e-21 92 31 6 231 3 rluD Ribosomal large subunit pseudouridine synthase D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KP71 1.04e-20 90 32 7 224 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9JVB6 1.26e-20 92 30 6 239 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q82WZ5 1.32e-20 92 31 5 220 3 rluD Ribosomal large subunit pseudouridine synthase D Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P57481 7.87e-20 89 26 5 226 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q45480 8.71e-20 89 30 8 253 3 ylyB Uncharacterized RNA pseudouridine synthase YlyB Bacillus subtilis (strain 168)
O67638 9.08e-20 89 30 9 250 3 aq_1758 Uncharacterized RNA pseudouridine synthase aq_1758 Aquifex aeolicus (strain VF5)
Q8K9J8 1.15e-19 89 27 4 235 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q1RJX7 1.18e-19 89 30 8 242 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia bellii (strain RML369-C)
Q8DEV0 1.28e-19 89 29 7 255 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio vulnificus (strain CMCP6)
Q8K9E9 2.8e-19 88 26 9 237 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0A5T3 6.16e-19 87 31 7 236 3 BQ2027_MB1567 Uncharacterized RNA pseudouridine synthase Mb1567 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ3 6.16e-19 87 31 7 236 1 Rv1540 Uncharacterized RNA pseudouridine synthase Rv1540 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHQ2 6.16e-19 87 31 7 236 3 MT1592 Uncharacterized RNA pseudouridine synthase MT1592 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9ZKP5 3.08e-17 81 31 9 212 3 jhp_0890 Uncharacterized RNA pseudouridine synthase jhp_0890 Helicobacter pylori (strain J99 / ATCC 700824)
P47451 8.24e-17 81 24 6 238 3 MG209 Uncharacterized RNA pseudouridine synthase MG209 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q89AD9 1.38e-16 80 28 7 228 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9ZDR7 1.95e-16 80 28 8 233 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia prowazekii (strain Madrid E)
P75485 1.98e-16 80 29 10 248 3 MPN_292 Uncharacterized RNA pseudouridine synthase MG209 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P74346 4.72e-16 79 30 9 239 3 slr1629 Uncharacterized RNA pseudouridine synthase slr1629 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4UKQ3 9.08e-16 78 27 7 228 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q12069 1.25e-15 79 29 4 183 1 PUS9 tRNA pseudouridine(32) synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P43930 1.35e-15 76 31 7 204 3 HI_0042 Uncharacterized RNA pseudouridine synthase HI_0042 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q92IS6 1.83e-15 77 27 7 228 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia conorii (strain ATCC VR-613 / Malish 7)
O50310 1.83e-15 77 26 9 271 3 Cpar_0723 Uncharacterized RNA pseudouridine synthase Cpar_0723 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
O25610 5.6e-15 75 30 9 212 3 HP_0956 Uncharacterized RNA pseudouridine synthase HP_0956 Helicobacter pylori (strain ATCC 700392 / 26695)
Q68XB2 7.74e-15 75 27 8 233 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia typhi (strain ATCC VR-144 / Wilmington)
O66114 1.06e-14 74 30 10 222 3 ZMO0505 Uncharacterized RNA pseudouridine synthase ZMO0505 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q12362 1.07e-14 76 29 5 183 1 RIB2 Bifunctional protein RIB2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O25114 2.75e-14 74 27 5 197 1 HP_0347 Uncharacterized RNA pseudouridine synthase HP_0347 Helicobacter pylori (strain ATCC 700392 / 26695)
P72970 4e-14 73 31 7 198 3 slr1592 Uncharacterized RNA pseudouridine synthase slr1592 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9ZMA1 4.82e-14 73 26 6 198 3 jhp_0321 Uncharacterized RNA pseudouridine synthase jhp_0321 Helicobacter pylori (strain J99 / ATCC 700824)
Q0DST9 3.05e-13 72 25 8 290 2 Os03g0288500 RNA pseudouridine synthase 5 Oryza sativa subsp. japonica
Q8IZ73 4.35e-13 72 28 5 184 1 RPUSD2 Pseudouridylate synthase RPUSD2 Homo sapiens
Q7XA65 8.74e-13 70 28 10 251 2 At1g56345 RNA pseudouridine synthase 1 Arabidopsis thaliana
P53294 1.06e-12 70 27 5 191 1 PUS6 tRNA pseudouridine(31) synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9LU60 1.29e-12 70 27 5 204 2 At5g51140 RNA pseudouridine synthase 7 Arabidopsis thaliana
Q149F1 2.21e-12 69 29 5 172 1 Rpusd2 Pseudouridylate synthase RPUSD2 Mus musculus
P59838 2.55e-12 68 23 7 239 3 rluD Ribosomal large subunit pseudouridine synthase D Blochmanniella floridana
Q9ZL98 3.27e-12 68 28 8 235 3 jhp_0682 Uncharacterized RNA pseudouridine synthase jhp_0682 Helicobacter pylori (strain J99 / ATCC 700824)
Q08C69 7.38e-12 67 26 8 218 2 rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Danio rerio
Q0E0Y3 9.54e-12 67 27 7 234 2 Os02g0512300 RNA pseudouridine synthase 7 Oryza sativa subsp. japonica
Q8VCZ8 1.51e-11 66 28 8 219 2 Rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Mus musculus
Q9UJJ7 3.24e-11 65 28 8 219 1 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Homo sapiens
Q09709 4.94e-11 65 27 5 186 3 SPAC18B11.02c Pseudouridylate synthase C18B11.02c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O25441 5.62e-11 65 26 7 230 3 HP_0745 Uncharacterized RNA pseudouridine synthase HP_0745 Helicobacter pylori (strain ATCC 700392 / 26695)
Q28C59 1.14e-10 64 27 11 270 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Xenopus tropicalis
Q6DBR0 1.16e-10 64 27 7 200 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Danio rerio
Q4QQT0 1.38e-10 64 27 12 278 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Rattus norvegicus
Q5M721 4.18e-10 62 26 9 216 2 At3g52260 RNA pseudouridine synthase 5 Arabidopsis thaliana
Q17QT4 5.15e-10 62 27 9 233 2 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Bos taurus
Q5E9Z1 1.18e-09 61 28 8 242 2 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Bos taurus
Q96CM3 5.13e-09 59 27 5 204 1 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Homo sapiens
Q5Z8P2 2.84e-08 57 23 8 245 2 Os06g0717400 RNA pseudouridine synthase 2, chloroplastic Oryza sativa subsp. japonica
Q0J4D4 5.35e-08 56 30 11 223 2 Os08g0520100 RNA pseudouridine synthase 3, mitochondrial Oryza sativa subsp. japonica
Q9CWX4 1.05e-07 55 27 11 276 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Mus musculus
Q3ECD0 1.36e-07 55 25 9 283 2 At1g76050 RNA pseudouridine synthase 2, chloroplastic Arabidopsis thaliana
O16686 2.18e-07 54 28 6 190 3 K07E8.7 Uncharacterized protein K07E8.7 Caenorhabditis elegans
Q2QNM3 2.8e-07 54 23 7 257 2 Os12g0560500 RNA pseudouridine synthase 1 Oryza sativa subsp. japonica
Q5XET6 5.34e-07 53 29 9 202 2 At1g78910 RNA pseudouridine synthase 3, mitochondrial Arabidopsis thaliana
Q8I3Z1 1.34e-05 49 36 2 74 1 PFE0570w MATH and LRR domain-containing protein PFE0570w Plasmodium falciparum (isolate 3D7)
P47610 1.84e-05 48 20 8 224 3 MG370 Uncharacterized RNA pseudouridine synthase MG370 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q6FS81 0.000235 44 22 6 183 3 PUS5 21S rRNA pseudouridine(2819) synthase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O67444 0.000359 44 27 7 170 3 aq_1464 Uncharacterized RNA pseudouridine synthase aq_1464 Aquifex aeolicus (strain VF5)
P75230 0.000498 44 20 6 222 3 MPN_548 Uncharacterized RNA pseudouridine synthase MG370 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09475
Feature type CDS
Gene truC
Product tRNA pseudouridine(65) synthase TruC
Location 35966 - 36739 (strand: -1)
Length 774 (nucleotides) / 257 (amino acids)
In genomic island -

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1135
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00849 RNA pseudouridylate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0564 Translation, ribosomal structure and biogenesis (J) J Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06175 tRNA pseudouridine65 synthase [EC:5.4.99.26] - -

Protein Sequence

MTQPLQDTPLPEKTLPEKPLLEICYQDEHIVAVNKPAGWLVHRSWLDRHETVFVMQTLRDQIGQHVFPVHRLDRPTSGVLLMGLSSEVARLLSQQLERHEMQKTYHAVVRGWIEETATLDYPLVEELDKIADKFAAEKPAQPAVTHYRPLAKVECPVAIGRYPTSRFTLTELKPETGRKHQLRRHMQHLRHPIIGDTAHGDLRQNRGFTEHFGSRRLMLHASELVLTHPVSGESLVLHAGFDETWQRVAEQLGWTLP

Flanking regions ( +/- flanking 50bp)

CGCTATCTGGTGCTGCTTGACCATTTACGGGCACTGGACGGGCTTTTCGCGTGACACAACCATTGCAGGACACGCCATTACCGGAAAAAACATTACCGGAAAAACCATTACTGGAAATCTGTTATCAGGATGAACATATCGTCGCGGTGAATAAACCCGCCGGATGGCTGGTGCACCGCAGCTGGCTTGACCGTCATGAAACGGTGTTTGTGATGCAGACACTGCGCGACCAGATAGGTCAGCATGTTTTTCCGGTTCACCGTCTCGACAGACCGACCTCCGGCGTCTTGCTGATGGGATTATCGTCTGAGGTGGCACGCCTCCTGTCACAACAGCTTGAGCGGCATGAAATGCAGAAAACCTATCATGCGGTGGTGCGCGGCTGGATAGAGGAAACGGCGACGCTGGATTACCCGCTGGTGGAAGAACTGGACAAAATCGCCGATAAATTTGCGGCGGAAAAACCGGCGCAACCGGCGGTGACACACTACCGTCCGCTGGCGAAAGTGGAGTGTCCGGTGGCTATCGGGCGTTACCCGACATCCCGTTTTACCCTGACGGAACTGAAACCGGAAACCGGACGCAAACACCAGTTGCGCCGCCATATGCAGCATCTGCGGCATCCGATTATCGGTGATACCGCCCACGGCGATCTGCGTCAGAACCGGGGATTCACAGAACATTTCGGCAGCCGCCGGCTGATGCTGCATGCATCGGAACTGGTACTGACACACCCGGTCAGCGGAGAGTCGCTGGTGCTGCATGCCGGTTTCGATGAAACCTGGCAGCGGGTGGCAGAACAGCTTGGCTGGACATTACCCTGATTTATTAATAATTTGATTTTACTGATGAAAAAGGACGGATAATGGCACGT