Homologs in group_1779

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12975 FBDBKF_12975 61.1 Morganella morganii S1 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
EHELCC_06290 EHELCC_06290 61.1 Morganella morganii S2 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
NLDBIP_06610 NLDBIP_06610 61.1 Morganella morganii S4 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
LHKJJB_03490 LHKJJB_03490 61.1 Morganella morganii S3 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
HKOGLL_06965 HKOGLL_06965 61.1 Morganella morganii S5 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
F4V73_RS16160 F4V73_RS16160 61.1 Morganella psychrotolerans - co-chaperone YbbN

Distribution of the homologs in the orthogroup group_1779

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1779

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77395 2.66e-126 363 62 0 284 1 cnoX Chaperedoxin Escherichia coli (strain K12)
P43786 1.32e-61 197 49 2 218 1 HI_1159 Uncharacterized protein HI_1159 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7M1B9 9.91e-14 69 33 1 107 1 trxA Thioredoxin Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
P64808 2.76e-13 72 34 1 108 3 BQ2027_MB1359 Uncharacterized protein Mb1359 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WG61 2.76e-13 72 34 1 108 1 Rv1324 Uncharacterized protein Rv1324 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG60 2.76e-13 72 34 1 108 3 MT1366 Uncharacterized protein MT1366 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P80579 1.18e-12 66 34 1 102 1 trxA Thioredoxin Alicyclobacillus acidocaldarius subsp. acidocaldarius
P12243 1.2e-11 63 33 2 98 3 trxA Thioredoxin 1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P00275 4.47e-11 62 34 1 93 1 None Thioredoxin C-1 Corynebacterium nephridii
P50338 5.5e-11 61 30 1 94 3 trxA Thioredoxin Griffithsia pacifica
P23400 6.61e-10 59 27 1 98 1 TRXM Thioredoxin M-type, chloroplastic Chlamydomonas reinhardtii
P10472 8.37e-10 58 32 1 95 1 trxA Thioredoxin Chlorobaculum thiosulfatiphilum
P43785 2.5e-09 57 28 1 87 3 trxA Thioredoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WG67 6.29e-09 56 29 0 91 1 trxA Thioredoxin Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG66 6.29e-09 56 29 0 91 3 trxA Thioredoxin Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A617 6.29e-09 56 29 0 91 3 trxA Thioredoxin Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q4L5F0 6.84e-09 55 28 1 101 3 trxA Thioredoxin Staphylococcus haemolyticus (strain JCSC1435)
P66928 1.18e-08 55 24 1 107 1 trxA Thioredoxin Helicobacter pylori (strain ATCC 700392 / 26695)
P66929 1.18e-08 55 24 1 107 3 trxA Thioredoxin Helicobacter pylori (strain J99 / ATCC 700824)
P0A4L2 1.32e-08 55 28 2 107 1 trxA Thioredoxin 1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A4L1 1.32e-08 55 28 2 107 3 trxA Thioredoxin 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8KE49 1.49e-08 55 31 0 83 3 trx2 Thioredoxin 2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q49WR2 1.67e-08 54 27 1 101 3 trxA Thioredoxin Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P07591 2.06e-08 56 28 1 101 1 None Thioredoxin M-type, chloroplastic Spinacia oleracea
P52230 2.08e-08 54 28 2 106 1 trxA Thioredoxin 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9SEU6 2.87e-08 56 27 2 110 2 At3g15360 Thioredoxin M4, chloroplastic Arabidopsis thaliana
Q6H7E4 2.93e-08 55 30 1 98 2 Os02g0639900 Thioredoxin M1, chloroplastic Oryza sativa subsp. japonica
P50254 3.22e-08 53 28 1 92 3 trxA Thioredoxin Neopyropia yezoensis
P51225 4.2e-08 53 28 1 92 3 trxA Thioredoxin Porphyra purpurea
Q8CPL5 4.21e-08 53 27 1 101 3 trxA Thioredoxin Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQ29 4.21e-08 53 27 1 101 3 trxA Thioredoxin Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P46843 5.16e-08 57 30 0 91 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
P37395 6.49e-08 53 27 0 85 3 trxA Thioredoxin Cyanidium caldarium
P0A0K5 7.32e-08 53 26 1 101 3 trxA Thioredoxin Staphylococcus aureus (strain MW2)
P0A0K6 7.32e-08 53 26 1 101 1 trxA Thioredoxin Staphylococcus aureus
Q6GA69 7.32e-08 53 26 1 101 3 trxA Thioredoxin Staphylococcus aureus (strain MSSA476)
Q6GHU0 7.32e-08 53 26 1 101 3 trxA Thioredoxin Staphylococcus aureus (strain MRSA252)
P99122 7.32e-08 53 26 1 101 1 trxA Thioredoxin Staphylococcus aureus (strain N315)
P0A0K4 7.32e-08 53 26 1 101 3 trxA Thioredoxin Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGT9 7.32e-08 53 26 1 101 3 trxA Thioredoxin Staphylococcus aureus (strain COL)
Q2YXD0 7.32e-08 53 26 1 101 3 trxA Thioredoxin Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZD2 7.32e-08 53 26 1 101 2 trxA Thioredoxin Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHT6 7.32e-08 53 26 1 101 3 trxA Thioredoxin Staphylococcus aureus (strain USA300)
P48384 8e-08 54 29 1 96 1 None Thioredoxin M-type, chloroplastic Pisum sativum
O30974 9.29e-08 52 31 1 90 1 trxA Thioredoxin Mycolicibacterium smegmatis
Q41864 1.52e-07 53 25 1 105 2 TRM1 Thioredoxin M-type, chloroplastic Zea mays
Q17424 1.52e-07 53 27 1 109 3 trx-2 Probable thioredoxin-2 Caenorhabditis elegans
Q9CM49 1.81e-07 52 30 0 76 3 trxA Thioredoxin Pasteurella multocida (strain Pm70)
P14949 2.62e-07 51 28 0 81 1 trxA Thioredoxin Bacillus subtilis (strain 168)
Q10057 2.86e-07 55 25 3 118 3 SPAC1F5.02 Putative protein disulfide-isomerase C1F5.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9X2T1 5.12e-07 50 26 1 83 3 trxA Thioredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9R6P9 6.11e-07 50 29 3 102 3 trxA Thioredoxin Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
P09856 7.44e-07 52 27 2 105 1 None Thioredoxin F-type, chloroplastic Spinacia oleracea
P08058 7.86e-07 50 26 0 86 1 trxA Thioredoxin Cereibacter sphaeroides
Q7X8R5 8.44e-07 51 28 1 98 2 Os04g0530600 Thioredoxin M2, chloroplastic Oryza sativa subsp. japonica
P52231 1.14e-06 49 27 0 86 1 trxA Thioredoxin Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0AGG7 2.48e-06 49 28 0 75 3 trxC Thioredoxin 2 Shigella flexneri
P0AGG4 2.48e-06 49 28 0 75 1 trxC Thioredoxin 2 Escherichia coli (strain K12)
P0AGG5 2.48e-06 49 28 0 75 3 trxC Thioredoxin 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGG6 2.48e-06 49 28 0 75 3 trxC Thioredoxin 2 Escherichia coli O157:H7
Q9ZEE0 2.58e-06 48 30 0 73 1 trxA Thioredoxin Rickettsia prowazekii (strain Madrid E)
Q9MAU6 2.58e-06 52 23 1 104 2 PDIL2-2 Protein disulfide-isomerase like 2-2 Arabidopsis thaliana
Q9MAU6 5.65e-05 47 25 2 101 2 PDIL2-2 Protein disulfide-isomerase like 2-2 Arabidopsis thaliana
P52233 2.8e-06 48 27 1 83 3 trxA Thioredoxin Acidithiobacillus ferridurans
P33791 2.85e-06 48 28 0 83 3 trxA Thioredoxin (Fragment) Kitasatospora aureofaciens
Q9ZP20 4.33e-06 49 26 0 82 2 TRXM Thioredoxin M5, chloroplastic Oryza sativa subsp. japonica
O22263 4.34e-06 51 27 2 91 2 PDIL2-1 Protein disulfide-isomerase like 2-1 Arabidopsis thaliana
Q942L2 4.64e-06 50 28 2 84 2 PDIL2-2 Protein disulfide isomerase-like 2-2 Oryza sativa subsp. japonica
Q4UNK3 5.17e-06 47 27 1 83 3 trxA Thioredoxin Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P97493 5.51e-06 48 30 0 86 1 Txn2 Thioredoxin, mitochondrial Mus musculus
Q10N04 6.02e-06 48 23 2 118 2 PDIL5-1 Protein disulfide isomerase-like 5-1 Oryza sativa subsp. japonica
Q68Y00 6.35e-06 47 25 2 98 3 trxA Thioredoxin Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P12865 6.96e-06 50 24 2 111 3 BS2 Bloodstream-specific protein 2 Trypanosoma brucei brucei
P12865 1.08e-05 50 27 4 104 3 BS2 Bloodstream-specific protein 2 Trypanosoma brucei brucei
P38661 7.01e-06 50 26 3 101 2 None Probable protein disulfide-isomerase A6 Medicago sativa
P38661 0.000275 45 29 2 88 2 None Probable protein disulfide-isomerase A6 Medicago sativa
P08003 7.6e-06 50 28 3 97 1 Pdia4 Protein disulfide-isomerase A4 Mus musculus
P08003 0.000141 46 28 3 108 1 Pdia4 Protein disulfide-isomerase A4 Mus musculus
Q99757 7.78e-06 48 30 0 86 1 TXN2 Thioredoxin, mitochondrial Homo sapiens
P97615 8.08e-06 48 30 0 86 2 Txn2 Thioredoxin, mitochondrial Rattus norvegicus
P52232 9.78e-06 47 27 0 72 1 slr0233 Thioredoxin-like protein slr0233 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q75M08 1.02e-05 50 27 2 84 2 PDIL2-1 Protein disulfide isomerase-like 2-1 Oryza sativa subsp. japonica
Q95108 1.09e-05 48 30 0 86 1 TXN2 Thioredoxin, mitochondrial Bos taurus
Q5JMR9 1.21e-05 48 27 1 87 3 Os01g0963400 Thioredoxin Y, chloroplastic Oryza sativa subsp. japonica
P38659 1.22e-05 50 28 3 97 1 Pdia4 Protein disulfide-isomerase A4 Rattus norvegicus
P38659 0.000117 47 27 3 108 1 Pdia4 Protein disulfide-isomerase A4 Rattus norvegicus
Q91W90 1.31e-05 49 25 2 110 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
Q91W90 0.000341 45 25 3 93 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
P47938 1.44e-05 46 23 1 101 1 dhd Thioredoxin-1 Drosophila melanogaster
Q9ZP21 1.49e-05 48 26 0 82 2 None Thioredoxin M-type, chloroplastic Triticum aestivum
Q29RV1 1.56e-05 49 28 4 114 2 PDIA4 Protein disulfide-isomerase A4 Bos taurus
Q92249 1.83e-05 49 28 5 105 2 erp38 Protein disulfide-isomerase erp38 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P60226 1.98e-05 46 22 1 101 2 dhd Thioredoxin-1 Drosophila yakuba
Q9V429 2.48e-05 45 30 0 86 1 Trx2 Thioredoxin-2 Drosophila melanogaster
Q67UF5 2.49e-05 48 26 2 111 2 PDIL2-3 Protein disulfide isomerase-like 2-3 Oryza sativa subsp. japonica
Q86IA3 2.53e-05 48 28 4 106 1 pdi1 Protein disulfide-isomerase 1 Dictyostelium discoideum
Q39239 2.58e-05 46 28 0 77 1 TRX4 Thioredoxin H4 Arabidopsis thaliana
Q9SEU8 2.66e-05 47 26 1 110 1 TRXM2 Thioredoxin M2, chloroplastic Arabidopsis thaliana
P10473 2.68e-05 45 29 0 64 1 trxA Thioredoxin Rhodospirillum rubrum
Q39362 2.82e-05 46 28 0 77 2 THL-2 Thioredoxin H-type 2 Brassica napus
Q9USR1 3.51e-05 48 28 2 94 4 txl1 Thioredoxin-like protein 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O48737 3.9e-05 47 28 1 87 1 At1g03680 Thioredoxin M1, chloroplastic Arabidopsis thaliana
P13667 4.16e-05 48 29 3 108 1 PDIA4 Protein disulfide-isomerase A4 Homo sapiens
P13667 0.000102 47 24 5 131 1 PDIA4 Protein disulfide-isomerase A4 Homo sapiens
O81332 4.19e-05 47 27 2 93 2 None Thioredoxin F-type, chloroplastic Mesembryanthemum crystallinum
P54399 4.4e-05 48 28 2 109 2 Pdi Protein disulfide-isomerase Drosophila melanogaster
Q92JR5 4.46e-05 45 25 1 88 3 trxA Thioredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q15084 5.45e-05 47 31 3 99 1 PDIA6 Protein disulfide-isomerase A6 Homo sapiens
Q5R6T1 6.02e-05 47 31 3 99 2 PDIA6 Protein disulfide-isomerase A6 Pongo abelii
P0AA30 6.24e-05 44 29 0 62 3 trxA Thioredoxin 1 Shigella flexneri
P0AA28 6.24e-05 44 29 0 62 1 trxA Thioredoxin 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA29 6.24e-05 44 29 0 62 1 trxA Thioredoxin 1 Salmonella typhi
P0AA25 6.24e-05 44 29 0 62 1 trxA Thioredoxin 1 Escherichia coli (strain K12)
P0AA26 6.24e-05 44 29 0 62 3 trxA Thioredoxin 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA27 6.24e-05 44 29 0 62 1 trxA Thioredoxin 1 Escherichia coli O157:H7
Q1RKN1 6.27e-05 44 26 0 71 3 trxA Thioredoxin Rickettsia bellii (strain RML369-C)
Q6XHI1 6.41e-05 44 29 0 86 3 Trx2 Thioredoxin-2 Drosophila yakuba
Q9PJK3 6.76e-05 44 28 2 100 3 trxA Thioredoxin Chlamydia muridarum (strain MoPn / Nigg)
Q5RDG4 8.86e-05 47 21 1 100 2 PDIA3 Protein disulfide-isomerase A3 Pongo abelii
P30101 8.86e-05 47 21 1 100 1 PDIA3 Protein disulfide-isomerase A3 Homo sapiens
P38657 9.52e-05 47 21 1 100 2 PDIA3 Protein disulfide-isomerase A3 Bos taurus
Q8IFW4 0.0001 45 24 0 91 1 TrxT Thioredoxin-T Drosophila melanogaster
Q8NBS9 0.000111 47 26 2 111 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
Q8NBS9 0.000185 46 26 3 93 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
P96132 0.000114 43 25 1 81 3 trxA Thioredoxin (Fragment) Thiocapsa roseopersicina
Q6NPF9 0.000117 45 26 0 72 1 At1g76760 Thioredoxin Y1, chloroplastic Arabidopsis thaliana
Q9RD25 0.000119 44 27 2 101 2 trxC Putative thioredoxin 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q4VIT4 0.000126 47 20 1 100 1 PDIA3 Protein disulfide-isomerase A3 Chlorocebus aethiops
Q9LKW0 0.000129 45 26 1 97 1 CITRX Thioredoxin-like protein CITRX, chloroplastic Solanum lycopersicum
Q43116 0.000136 46 26 2 106 2 None Protein disulfide-isomerase Ricinus communis
P11598 0.000146 46 20 1 98 1 Pdia3 Protein disulfide-isomerase A3 Rattus norvegicus
P27773 0.000149 46 20 1 98 1 Pdia3 Protein disulfide-isomerase A3 Mus musculus
M1A3D5 0.000152 45 26 1 97 3 CITRX Thioredoxin-like protein CITRX, chloroplastic Solanum tuberosum
P38660 0.000193 46 30 3 99 1 PDIA6 Protein disulfide-isomerase A6 Mesocricetus auratus
P38660 0.000227 45 27 3 99 1 PDIA6 Protein disulfide-isomerase A6 Mesocricetus auratus
O48773 0.000204 46 25 3 102 2 PDIL2-3 Protein disulfide-isomerase 2-3 Arabidopsis thaliana
O48773 0.000218 45 25 2 101 2 PDIL2-3 Protein disulfide-isomerase 2-3 Arabidopsis thaliana
Q6JE37 0.000233 44 26 1 104 1 CITRX2 Thioredoxin-like protein CITRX2, chloroplastic Nicotiana benthamiana
Q9VYV3 0.000233 45 20 2 124 1 prtp Thioredoxin domain-containing protein 5 homolog Drosophila melanogaster
Q63081 0.000234 45 30 3 99 1 Pdia6 Protein disulfide-isomerase A6 Rattus norvegicus
O22022 0.000238 43 27 1 79 3 trxA Thioredoxin Cyanidioschyzon merolae (strain NIES-3377 / 10D)
O51088 0.000256 43 30 1 69 3 trxA Thioredoxin Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q922R8 0.000265 45 30 3 99 1 Pdia6 Protein disulfide-isomerase A6 Mus musculus
Q17967 0.000275 45 29 2 89 3 pdi-1 Protein disulfide-isomerase 1 Caenorhabditis elegans
P34329 0.000313 45 23 3 116 3 C14B9.2 Probable protein disulfide-isomerase A4 Caenorhabditis elegans
P34329 0.000336 45 24 3 106 3 C14B9.2 Probable protein disulfide-isomerase A4 Caenorhabditis elegans
Q6JE38 0.000321 44 26 1 104 2 CITRX1 Thioredoxin-like protein CITRX1, chloroplastic Nicotiana benthamiana
Q1RQI9 0.000438 42 26 1 78 1 None Thioredoxin (Fragment) Malassezia sympodialis
Q17770 0.000481 45 30 4 93 1 pdi-2 Protein disulfide-isomerase 2 Caenorhabditis elegans
P05307 0.000533 45 25 5 135 1 P4HB Protein disulfide-isomerase Bos taurus
Q8IDP4 0.000656 42 25 1 77 1 TRX2 Thioredoxin 2 Plasmodium falciparum (isolate 3D7)
P52227 0.000784 41 26 1 84 3 trxA Thioredoxin Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9XF61 0.000789 44 29 5 112 2 PDI Protein disulfide-isomerase Datisca glomerata
P07887 0.000817 41 24 1 97 1 None Thioredoxin C-2 Corynebacterium nephridii
Q9XGS0 0.000891 42 23 1 94 1 None Thioredoxin M-type, chloroplastic Brassica napus
Q8L7S9 0.0009 42 24 0 91 2 At1g43560 Thioredoxin Y2, chloroplastic Arabidopsis thaliana
Q5R5B6 0.001 43 25 5 135 2 P4HB Protein disulfide-isomerase Pongo abelii

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10690
Feature type CDS
Gene -
Product co-chaperone YbbN
Location 2350476 - 2351333 (strand: 1)
Length 858 (nucleotides) / 285 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1779
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00085 Thioredoxin
PF14559 Tetratricopeptide repeat
PF14561 Tetratricopeptide repeat

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3118 Posttranslational modification, protein turnover, chaperones (O) O Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05838 putative thioredoxin - -

Protein Sequence

MLATAHIVDVNESNIQQVIEQSMTKPVMMYFYSERSPHCAELGATLDKLAAEFADQFVLAKLDCDVEQMIASQFGLRAIPTVYILQEGRPVDGFQGPQPEEAIRQILANILPKPEELKAAQASALLAEGKADEALPLLKEAHQIDPKNSEITLALAGALISLNKHNEAEELLAAIPLQDQDSYYHSLLAQIELQKQAADTPEIQQLQDNFNQQPDNTELAIQLALKLHEVARNDEALELLFNFLKKDLNAGEGQVKKTLMDILSALGTNDNLASKYRRMVYSLLY

Flanking regions ( +/- flanking 50bp)

AGCGTAATAAACAGCATTTATATTTAAAACTCTCAAAAAGGGATAAGTTAATGTTAGCAACTGCACATATTGTTGATGTAAATGAATCGAATATTCAGCAAGTTATAGAACAATCGATGACAAAACCGGTCATGATGTACTTCTATTCAGAGCGTAGTCCTCATTGTGCAGAGCTTGGGGCAACGTTGGATAAACTAGCGGCTGAATTTGCTGATCAGTTTGTATTAGCTAAATTAGATTGTGATGTTGAACAGATGATTGCCTCGCAATTTGGTCTACGTGCGATCCCAACTGTTTATATATTGCAAGAAGGTCGTCCTGTCGATGGGTTCCAAGGCCCACAACCTGAAGAAGCTATTCGCCAAATCCTTGCCAATATCTTACCTAAACCAGAAGAATTAAAAGCAGCGCAAGCTTCAGCACTATTAGCAGAAGGTAAAGCAGACGAAGCATTACCACTGTTAAAAGAAGCACACCAAATTGATCCTAAAAACAGTGAAATTACCTTAGCCCTCGCAGGTGCTTTAATTTCATTAAATAAACATAATGAAGCAGAAGAATTATTAGCCGCAATTCCATTGCAAGATCAAGATAGCTATTATCATAGTTTATTAGCTCAAATTGAACTGCAAAAACAAGCTGCCGACACACCTGAAATTCAGCAATTACAAGATAATTTTAATCAGCAACCTGACAATACTGAACTCGCTATTCAACTGGCGTTAAAACTGCATGAAGTGGCACGTAATGATGAAGCCCTTGAATTGCTATTTAATTTTCTGAAAAAAGATCTTAATGCCGGTGAAGGACAAGTTAAGAAAACCCTGATGGATATTTTATCTGCTTTAGGGACTAATGATAATCTAGCATCTAAATATCGCCGAATGGTGTATTCTTTACTTTATTAATATTCATTTTATTTATTAAAGCAGGCTAAGGACAGATACATGGAAATAGT