Homologs in group_1779

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12975 FBDBKF_12975 88.4 Morganella morganii S1 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
EHELCC_06290 EHELCC_06290 88.4 Morganella morganii S2 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
NLDBIP_06610 NLDBIP_06610 88.4 Morganella morganii S4 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
LHKJJB_03490 LHKJJB_03490 88.4 Morganella morganii S3 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
HKOGLL_06965 HKOGLL_06965 88.4 Morganella morganii S5 cnoX Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family
PMI_RS10690 PMI_RS10690 61.1 Proteus mirabilis HI4320 - co-chaperone YbbN

Distribution of the homologs in the orthogroup group_1779

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1779

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77395 2.1e-117 341 58 0 278 1 cnoX Chaperedoxin Escherichia coli (strain K12)
P43786 4.44e-65 206 46 2 218 1 HI_1159 Uncharacterized protein HI_1159 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7M1B9 1.91e-13 68 32 1 107 1 trxA Thioredoxin Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
P64808 3.91e-13 71 33 2 143 3 BQ2027_MB1359 Uncharacterized protein Mb1359 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WG61 3.91e-13 71 33 2 143 1 Rv1324 Uncharacterized protein Rv1324 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG60 3.91e-13 71 33 2 143 3 MT1366 Uncharacterized protein MT1366 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4L2 2.43e-12 65 33 2 103 1 trxA Thioredoxin 1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A4L1 2.43e-12 65 33 2 103 3 trxA Thioredoxin 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q17424 3.95e-12 65 31 1 113 3 trx-2 Probable thioredoxin-2 Caenorhabditis elegans
P12243 2.43e-11 62 31 2 103 3 trxA Thioredoxin 1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P51225 2.97e-11 62 28 1 105 3 trxA Thioredoxin Porphyra purpurea
P50254 3.98e-11 62 28 1 105 3 trxA Thioredoxin Neopyropia yezoensis
P50338 1.26e-10 60 30 1 105 3 trxA Thioredoxin Griffithsia pacifica
Q41864 1.27e-10 62 26 1 101 2 TRM1 Thioredoxin M-type, chloroplastic Zea mays
P52231 1.38e-10 60 31 1 102 1 trxA Thioredoxin Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P33791 1.84e-10 60 31 1 105 3 trxA Thioredoxin (Fragment) Kitasatospora aureofaciens
P07591 2.15e-10 62 28 1 103 1 None Thioredoxin M-type, chloroplastic Spinacia oleracea
O83889 2.82e-10 59 28 2 102 3 trxA Thioredoxin Treponema pallidum (strain Nichols)
Q9CM49 4.4e-10 59 33 2 86 3 trxA Thioredoxin Pasteurella multocida (strain Pm70)
Q95108 5.64e-10 60 34 0 88 1 TXN2 Thioredoxin, mitochondrial Bos taurus
P97493 5.69e-10 60 31 2 121 1 Txn2 Thioredoxin, mitochondrial Mus musculus
P43785 7.28e-10 58 30 1 82 3 trxA Thioredoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AGG7 8.26e-10 59 31 0 87 3 trxC Thioredoxin 2 Shigella flexneri
P0AGG4 8.26e-10 59 31 0 87 1 trxC Thioredoxin 2 Escherichia coli (strain K12)
P0AGG5 8.26e-10 59 31 0 87 3 trxC Thioredoxin 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGG6 8.26e-10 59 31 0 87 3 trxC Thioredoxin 2 Escherichia coli O157:H7
P08058 8.77e-10 58 32 0 87 1 trxA Thioredoxin Cereibacter sphaeroides
Q99757 1.09e-09 59 34 0 88 1 TXN2 Thioredoxin, mitochondrial Homo sapiens
P97615 1.19e-09 59 34 0 88 2 Txn2 Thioredoxin, mitochondrial Rattus norvegicus
P23400 1.47e-09 58 28 1 102 1 TRXM Thioredoxin M-type, chloroplastic Chlamydomonas reinhardtii
P00275 2.42e-09 57 33 1 83 1 None Thioredoxin C-1 Corynebacterium nephridii
Q9ZP21 2.46e-09 58 26 1 101 2 None Thioredoxin M-type, chloroplastic Triticum aestivum
Q498R3 2.57e-09 61 26 3 126 2 Dnajc10 DnaJ homolog subfamily C member 10 Rattus norvegicus
Q498R3 0.000443 45 26 2 104 2 Dnajc10 DnaJ homolog subfamily C member 10 Rattus norvegicus
P48384 3.02e-09 58 26 1 102 1 None Thioredoxin M-type, chloroplastic Pisum sativum
Q9ZP20 3.07e-09 58 27 0 88 2 TRXM Thioredoxin M5, chloroplastic Oryza sativa subsp. japonica
Q9MAU6 3.93e-09 60 32 3 104 2 PDIL2-2 Protein disulfide-isomerase like 2-2 Arabidopsis thaliana
Q9MAU6 4.34e-08 57 29 1 97 2 PDIL2-2 Protein disulfide-isomerase like 2-2 Arabidopsis thaliana
Q9DC23 4.06e-09 60 26 3 126 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
Q9DC23 0.000544 45 25 2 104 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
P37395 6.58e-09 55 28 0 81 3 trxA Thioredoxin Cyanidium caldarium
P66928 7.1e-09 55 27 2 107 1 trxA Thioredoxin Helicobacter pylori (strain ATCC 700392 / 26695)
P66929 7.1e-09 55 27 2 107 3 trxA Thioredoxin Helicobacter pylori (strain J99 / ATCC 700824)
Q6H7E4 8.31e-09 57 28 1 103 2 Os02g0639900 Thioredoxin M1, chloroplastic Oryza sativa subsp. japonica
P9WG67 1.07e-08 55 30 1 113 1 trxA Thioredoxin Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG66 1.07e-08 55 30 1 113 3 trxA Thioredoxin Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A617 1.07e-08 55 30 1 113 3 trxA Thioredoxin Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P10472 1.1e-08 55 35 2 80 1 trxA Thioredoxin Chlorobaculum thiosulfatiphilum
Q8IXB1 1.55e-08 58 25 3 126 1 DNAJC10 DnaJ homolog subfamily C member 10 Homo sapiens
Q9SEU6 1.7e-08 57 28 0 87 2 At3g15360 Thioredoxin M4, chloroplastic Arabidopsis thaliana
Q5R5L3 1.79e-08 58 25 3 126 2 DNAJC10 DnaJ homolog subfamily C member 10 Pongo abelii
Q8KE49 1.82e-08 54 33 1 81 3 trx2 Thioredoxin 2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P80579 3.49e-08 53 30 1 102 1 trxA Thioredoxin Alicyclobacillus acidocaldarius subsp. acidocaldarius
O48737 7.95e-08 54 30 0 86 1 At1g03680 Thioredoxin M1, chloroplastic Arabidopsis thaliana
Q7X8R5 8.64e-08 54 27 1 103 2 Os04g0530600 Thioredoxin M2, chloroplastic Oryza sativa subsp. japonica
Q4L5F0 1.16e-07 52 28 2 102 3 trxA Thioredoxin Staphylococcus haemolyticus (strain JCSC1435)
P0A0K5 1.2e-07 52 27 2 102 3 trxA Thioredoxin Staphylococcus aureus (strain MW2)
P0A0K6 1.2e-07 52 27 2 102 1 trxA Thioredoxin Staphylococcus aureus
Q6GA69 1.2e-07 52 27 2 102 3 trxA Thioredoxin Staphylococcus aureus (strain MSSA476)
Q6GHU0 1.2e-07 52 27 2 102 3 trxA Thioredoxin Staphylococcus aureus (strain MRSA252)
P99122 1.2e-07 52 27 2 102 1 trxA Thioredoxin Staphylococcus aureus (strain N315)
P0A0K4 1.2e-07 52 27 2 102 3 trxA Thioredoxin Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGT9 1.2e-07 52 27 2 102 3 trxA Thioredoxin Staphylococcus aureus (strain COL)
Q2YXD0 1.2e-07 52 27 2 102 3 trxA Thioredoxin Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZD2 1.2e-07 52 27 2 102 2 trxA Thioredoxin Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHT6 1.2e-07 52 27 2 102 3 trxA Thioredoxin Staphylococcus aureus (strain USA300)
Q6NRT6 1.5e-07 56 26 2 115 2 dnajc10 DnaJ homolog subfamily C member 10 Xenopus laevis
O48773 1.52e-07 55 27 6 167 2 PDIL2-3 Protein disulfide-isomerase 2-3 Arabidopsis thaliana
O48773 7.23e-06 50 30 3 98 2 PDIL2-3 Protein disulfide-isomerase 2-3 Arabidopsis thaliana
O22022 2.62e-07 51 32 1 81 3 trxA Thioredoxin Cyanidioschyzon merolae (strain NIES-3377 / 10D)
Q9SEU8 4.1e-07 52 29 0 87 1 TRXM2 Thioredoxin M2, chloroplastic Arabidopsis thaliana
Q5RDG4 4.42e-07 54 27 0 79 2 PDIA3 Protein disulfide-isomerase A3 Pongo abelii
P30101 4.42e-07 54 27 0 79 1 PDIA3 Protein disulfide-isomerase A3 Homo sapiens
Q4VIT4 4.46e-07 54 27 0 79 1 PDIA3 Protein disulfide-isomerase A3 Chlorocebus aethiops
P27773 5.06e-07 54 27 0 79 1 Pdia3 Protein disulfide-isomerase A3 Mus musculus
P11598 5.16e-07 54 27 0 79 1 Pdia3 Protein disulfide-isomerase A3 Rattus norvegicus
P38657 5.3e-07 54 27 0 79 2 PDIA3 Protein disulfide-isomerase A3 Bos taurus
Q49WR2 6.28e-07 50 27 2 102 3 trxA Thioredoxin Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q869Z0 6.75e-07 53 24 4 166 1 DDB_G0275025 Putative protein disulfide-isomerase DDB_G0275025 Dictyostelium discoideum
Q4UNK3 6.81e-07 50 25 1 103 3 trxA Thioredoxin Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9XGS0 7.58e-07 51 26 1 102 1 None Thioredoxin M-type, chloroplastic Brassica napus
Q8CPL5 7.8e-07 50 26 2 102 3 trxA Thioredoxin Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQ29 7.8e-07 50 26 2 102 3 trxA Thioredoxin Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0AA30 1.33e-06 49 29 0 77 3 trxA Thioredoxin 1 Shigella flexneri
P0AA28 1.33e-06 49 29 0 77 1 trxA Thioredoxin 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA29 1.33e-06 49 29 0 77 1 trxA Thioredoxin 1 Salmonella typhi
P0AA25 1.33e-06 49 29 0 77 1 trxA Thioredoxin 1 Escherichia coli (strain K12)
P0AA26 1.33e-06 49 29 0 77 3 trxA Thioredoxin 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA27 1.33e-06 49 29 0 77 1 trxA Thioredoxin 1 Escherichia coli O157:H7
P38661 1.47e-06 52 29 3 81 2 None Probable protein disulfide-isomerase A6 Medicago sativa
Q10057 1.52e-06 52 25 4 144 3 SPAC1F5.02 Putative protein disulfide-isomerase C1F5.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O22263 1.92e-06 52 27 3 83 2 PDIL2-1 Protein disulfide-isomerase like 2-1 Arabidopsis thaliana
Q10N04 2.33e-06 49 29 4 99 2 PDIL5-1 Protein disulfide isomerase-like 5-1 Oryza sativa subsp. japonica
Q8JG64 3.54e-06 51 26 0 79 2 PDIA3 Protein disulfide-isomerase A3 Gallus gallus
Q67UF5 5.05e-06 51 29 1 96 2 PDIL2-3 Protein disulfide isomerase-like 2-3 Oryza sativa subsp. japonica
Q67UF5 9.26e-05 47 27 1 81 2 PDIL2-3 Protein disulfide isomerase-like 2-3 Oryza sativa subsp. japonica
P46843 5.24e-06 51 29 0 88 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
Q92JR5 6.84e-06 47 24 1 101 3 trxA Thioredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q0JD42 7.95e-06 50 29 3 98 2 PDIL5-2 Protein disulfide isomerase-like 5-2 Oryza sativa subsp. japonica
Q8NBS9 9.05e-06 50 27 3 113 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
Q8NBS9 4.23e-05 48 30 2 80 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
Q8NBS9 0.000221 45 27 1 79 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
P59527 9.7e-06 47 28 1 97 3 trxA Thioredoxin Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q942L2 1.01e-05 50 29 3 81 2 PDIL2-2 Protein disulfide isomerase-like 2-2 Oryza sativa subsp. japonica
Q9X2T1 1.46e-05 46 25 2 85 3 trxA Thioredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q91W90 1.57e-05 49 29 2 92 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
Q91W90 1.71e-05 49 28 2 80 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
Q91W90 2.41e-05 48 27 1 79 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
P52232 1.72e-05 46 29 0 71 1 slr0233 Thioredoxin-like protein slr0233 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P52233 2.2e-05 46 28 1 92 3 trxA Thioredoxin Acidithiobacillus ferridurans
P52230 2.41e-05 46 24 1 106 1 trxA Thioredoxin 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P38658 2.45e-05 48 29 4 89 3 None Probable protein disulfide-isomerase ER-60 Schistosoma mansoni
Q8VX13 2.47e-05 48 29 0 79 2 PDIL1-3 Protein disulfide isomerase-like 1-3 Arabidopsis thaliana
Q92249 3.26e-05 48 30 5 105 2 erp38 Protein disulfide-isomerase erp38 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q75M08 3.68e-05 48 27 3 81 2 PDIL2-1 Protein disulfide isomerase-like 2-1 Oryza sativa subsp. japonica
Q0E0I1 3.93e-05 48 26 4 112 3 PDIL5-3 Protein disulfide isomerase-like 5-3 Oryza sativa subsp. japonica
O13704 3.93e-05 48 21 3 125 4 SPAC13F5.05 Thioredoxin domain-containing protein C13F5.05, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P52227 5.01e-05 45 32 2 74 3 trxA Thioredoxin Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q68Y00 5.94e-05 44 23 2 105 3 trxA Thioredoxin Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q39362 7.2e-05 45 28 0 75 2 THL-2 Thioredoxin H-type 2 Brassica napus
P10473 8.03e-05 44 26 1 82 1 trxA Thioredoxin Rhodospirillum rubrum
Q1RKN1 8.36e-05 44 27 0 72 3 trxA Thioredoxin Rickettsia bellii (strain RML369-C)
Q1RQI9 8.7e-05 44 34 2 70 1 None Thioredoxin (Fragment) Malassezia sympodialis
Q39239 9.92e-05 44 26 2 106 1 TRX4 Thioredoxin H4 Arabidopsis thaliana
P09856 0.000131 45 26 2 95 1 None Thioredoxin F-type, chloroplastic Spinacia oleracea
P13667 0.000134 47 27 3 105 1 PDIA4 Protein disulfide-isomerase A4 Homo sapiens
O30974 0.000138 43 27 2 100 1 trxA Thioredoxin Mycolicibacterium smegmatis
Q9ZEE0 0.000139 43 24 0 85 1 trxA Thioredoxin Rickettsia prowazekii (strain Madrid E)
Q29RV1 0.00014 47 31 2 80 2 PDIA4 Protein disulfide-isomerase A4 Bos taurus
P09857 0.000158 43 31 0 64 1 trxA Thioredoxin Allochromatium vinosum
Q9XI01 0.000207 46 30 4 100 1 PDIL1-1 Protein disulfide isomerase-like 1-1 Arabidopsis thaliana
P07887 0.000208 43 26 2 94 1 None Thioredoxin C-2 Corynebacterium nephridii
Q9VYV3 0.000215 45 24 1 94 1 prtp Thioredoxin domain-containing protein 5 homolog Drosophila melanogaster
Q9VYV3 0.001 43 29 3 87 1 prtp Thioredoxin domain-containing protein 5 homolog Drosophila melanogaster
P96132 0.000251 42 29 0 64 3 trxA Thioredoxin (Fragment) Thiocapsa roseopersicina
P54399 0.000279 45 31 2 102 2 Pdi Protein disulfide-isomerase Drosophila melanogaster
P38659 0.000284 45 26 3 105 1 Pdia4 Protein disulfide-isomerase A4 Rattus norvegicus
Q9PJK3 0.000317 42 31 2 83 3 trxA Thioredoxin Chlamydia muridarum (strain MoPn / Nigg)
P12865 0.000319 45 27 0 77 3 BS2 Bloodstream-specific protein 2 Trypanosoma brucei brucei
Q17967 0.00033 45 23 2 135 3 pdi-1 Protein disulfide-isomerase 1 Caenorhabditis elegans
P08003 0.00038 45 26 3 105 1 Pdia4 Protein disulfide-isomerase A4 Mus musculus
O94504 0.00038 43 35 3 87 1 trx2 Thioredoxin-2, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9SEU7 0.000392 43 25 0 78 2 GAT1 Thioredoxin M3, chloroplastic Arabidopsis thaliana
Q8TFM8 0.000525 42 29 3 88 1 None Thioredoxin-like protein Fusarium culmorum
Q8IFW4 0.000572 43 21 1 115 1 TrxT Thioredoxin-T Drosophila melanogaster
Q9SRG3 0.000635 44 29 6 125 2 PDIL1-2 Protein disulfide isomerase-like 1-2 Arabidopsis thaliana
Q8KEA4 0.000699 41 27 0 66 3 trx1 Thioredoxin 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9USR1 0.001 43 32 2 64 4 txl1 Thioredoxin-like protein 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16160
Feature type CDS
Gene -
Product co-chaperone YbbN
Location 35334 - 36200 (strand: 1)
Length 867 (nucleotides) / 288 (amino acids)

Contig

Accession term accessions NZ_VXKB01000006 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1779
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00085 Thioredoxin
PF14559 Tetratricopeptide repeat
PF14561 Tetratricopeptide repeat

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3118 Posttranslational modification, protein turnover, chaperones (O) O Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05838 putative thioredoxin - -

Protein Sequence

MLSNANNTHSTDVNESNLRQVIDASMQVPVVFFFHSPQSPQCQELGVTLEKIAAEYAGMMILARVNCDTEQMIASQFGLRAVPTTYLFREGQPVDGFEGPQSEETIRTFLAKFLPNESEIKAGQAIELIEAGDFQAALPLLRDAHQLDERNSEITLLLVQTLLEVNLSEEAEKVLKSVPIQDQDTRYHSFLSQIELQKQAADTPEIQELQTAFAADAENAELAVQLALKLHEVHRNDEALPLLFSFLKRDLGAAEGRVRKTMMDIMAAMGTADSTAASYRRKLYSLLY

Flanking regions ( +/- flanking 50bp)

CAGCGCCCAGATGTTAACTTTAAGTCCGCCAATTTATTAAGAGAATGAATATGTTATCAAACGCGAATAACACACACAGCACTGATGTTAACGAAAGCAACTTACGCCAGGTTATTGACGCCTCCATGCAGGTGCCGGTTGTTTTTTTCTTCCATTCCCCGCAATCACCGCAATGTCAGGAGCTGGGTGTCACTCTGGAAAAAATCGCTGCTGAATATGCCGGAATGATGATCCTCGCCAGAGTGAACTGCGATACCGAACAGATGATTGCATCCCAGTTTGGTCTGCGCGCGGTGCCGACAACCTATTTGTTCCGTGAAGGGCAACCCGTTGACGGGTTTGAAGGACCACAGAGTGAAGAAACCATCCGCACATTTTTAGCTAAATTCCTGCCAAATGAATCAGAAATAAAAGCAGGACAAGCAATCGAACTGATTGAAGCGGGTGATTTTCAGGCGGCTTTACCGCTGCTGCGTGATGCGCATCAGCTTGATGAACGCAACAGTGAGATCACGTTGCTGCTGGTGCAGACATTACTGGAAGTTAATCTTTCGGAAGAAGCTGAAAAAGTATTGAAGTCTGTCCCGATTCAGGATCAGGATACGCGCTATCATAGTTTCTTATCTCAAATTGAATTACAAAAACAAGCAGCGGATACCCCTGAAATTCAGGAGCTGCAAACGGCATTTGCCGCAGATGCTGAAAATGCGGAACTCGCGGTACAACTGGCGCTGAAGCTGCATGAAGTTCATCGTAATGATGAAGCTCTGCCACTGTTATTCAGCTTCCTGAAACGCGATTTGGGTGCGGCGGAAGGTCGTGTGCGTAAAACGATGATGGATATTATGGCGGCAATGGGCACGGCGGATAGTACTGCCGCATCTTATCGCCGTAAGCTATACTCATTACTCTACTAATTATACTATACCCAACGTCATTCAAGATGCAGGCAGGCGGCAAGGGAAGA