Homologs in group_906

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04785 FBDBKF_04785 61.3 Morganella morganii S1 kbaY tagatose-bisphosphate aldolase subunit KbaY
EHELCC_06075 EHELCC_06075 61.3 Morganella morganii S2 kbaY tagatose-bisphosphate aldolase subunit KbaY
NLDBIP_06395 NLDBIP_06395 61.3 Morganella morganii S4 kbaY tagatose-bisphosphate aldolase subunit KbaY
LHKJJB_03275 LHKJJB_03275 61.3 Morganella morganii S3 kbaY tagatose-bisphosphate aldolase subunit KbaY
HKOGLL_06750 HKOGLL_06750 61.3 Morganella morganii S5 kbaY tagatose-bisphosphate aldolase subunit KbaY
F4V73_RS09255 F4V73_RS09255 63.0 Morganella psychrotolerans kbaY tagatose-bisphosphate aldolase subunit KbaY

Distribution of the homologs in the orthogroup group_906

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_906

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CPQ7 3.57e-143 406 65 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGZ9 3.57e-143 406 65 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella typhi
A9N6Z8 7.36e-143 405 65 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5BGG5 1.99e-141 402 65 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi A (strain AKU_12601)
Q5PL86 1.99e-141 402 65 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A6TEF4 3.9e-140 399 64 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4T6B9 1.89e-136 389 64 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella newport (strain SL254)
B4TWB0 6.57e-136 388 63 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella schwarzengrund (strain CVM19633)
C0PZ24 7.5e-136 388 63 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi C (strain RKS4594)
B4TIX9 7.5e-136 388 63 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella heidelberg (strain SL476)
B5REK6 7.5e-136 388 63 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZS8 7.5e-136 388 63 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella enteritidis PT4 (strain P125109)
Q57JK9 1.03e-134 385 63 0 284 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella choleraesuis (strain SC-B67)
Q8VS16 9.7e-130 372 61 0 284 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Klebsiella oxytoca
A9MPP7 2.55e-127 366 60 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AQ28 3.2e-125 361 60 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P0C8J6 2.29e-124 358 60 0 283 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12)
B1IYY4 2.29e-124 358 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A1W1 2.29e-124 358 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O9:H4 (strain HS)
B1X7I7 2.29e-124 358 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12 / DH10B)
C4ZSI0 2.29e-124 358 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12 / MC4100 / BW2952)
B7NPN7 2.45e-124 358 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LN92 3.83e-124 358 61 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain SMS-3-5 / SECEC)
Q3Z0B4 6.07e-124 358 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella sonnei (strain Ss046)
B2TY92 7.31e-124 357 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7NCC6 7.31e-124 357 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7M477 7.31e-124 357 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O8 (strain IAI1)
Q8FFY7 1.57e-123 357 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFZ6 1.57e-123 357 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A4WEV6 1.61e-123 357 59 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Enterobacter sp. (strain 638)
Q1R9X7 4.9e-123 355 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain UTI89 / UPEC)
A1ACW2 4.9e-123 355 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O1:K1 / APEC
B7MEF1 4.9e-123 355 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZNR5 6.23e-123 355 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0T342 8.94e-123 355 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella flexneri serotype 5b (strain 8401)
B7UFB3 8.94e-123 355 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5YV43 1.04e-122 354 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4R2 1.04e-122 354 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O157:H7
Q83QY5 2.39e-122 353 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella flexneri
Q323C6 2.45e-122 353 59 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella boydii serotype 4 (strain Sb227)
B7L9W7 4e-122 353 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain 55989 / EAEC)
B1LFP2 5.58e-122 353 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain SMS-3-5 / SECEC)
B7NDC5 5.58e-122 353 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NKL0 9.74e-122 352 58 0 280 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q1R6K0 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain UTI89 / UPEC)
B6I1L2 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain SE11)
P0AB74 1.04e-121 352 58 0 284 1 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12)
B1IRH9 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AB75 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCW8 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AG46 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O1:K1 / APEC
A8A4V3 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O9:H4 (strain HS)
B1XGU9 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12 / DH10B)
C4ZR47 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12 / MC4100 / BW2952)
B7M045 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O8 (strain IAI1)
B7N0S6 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O81 (strain ED1a)
B5YS30 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AB76 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O157:H7
B7LH72 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain 55989 / EAEC)
B7MB62 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZS33 1.04e-121 352 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O139:H28 (strain E24377A / ETEC)
P0C8J7 1.11e-121 352 59 0 283 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli
Q32EA9 1.28e-121 352 60 0 283 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella dysenteriae serotype 1 (strain Sd197)
Q9KIP8 1.46e-121 352 58 0 284 1 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli
B7UJ37 8.87e-121 350 58 0 284 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LMU4 1.17e-119 347 58 0 280 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P94453 9.74e-77 238 43 3 286 3 fba Fructose-bisphosphate aldolase Geobacillus stearothermophilus
P13243 5.15e-76 236 42 3 279 1 fbaA Probable fructose-bisphosphate aldolase Bacillus subtilis (strain 168)
Q703I2 7.53e-72 226 41 3 304 1 fba Fructose-bisphosphate aldolase Thermus caldophilus
A0A2P6MHY1 2.51e-70 221 40 0 283 1 sqiA Sulfofructosephosphate aldolase Alkalicoccus urumqiensis
A8B2U2 2.31e-69 220 38 4 308 1 fba Fructose-bisphosphate aldolase Giardia intestinalis (strain ATCC 50803 / WB clone C6)
Q8CNI3 2.95e-69 219 40 2 279 3 fba Fructose-bisphosphate aldolase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM97 2.95e-69 219 40 2 279 3 fba Fructose-bisphosphate aldolase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P67478 1.75e-68 217 40 2 279 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MW2)
Q6G7I5 1.75e-68 217 40 2 279 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MSSA476)
Q6GEV0 1.75e-68 217 40 2 279 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MRSA252)
P99075 1.75e-68 217 40 2 279 1 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain N315)
P67477 1.75e-68 217 40 2 279 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HE75 1.75e-68 217 40 2 279 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain COL)
Q65D09 1.29e-67 214 41 5 287 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P56109 1.86e-65 209 38 3 306 1 fba Fructose-bisphosphate aldolase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZMQ6 3.6e-65 209 39 4 307 3 fba Fructose-bisphosphate aldolase Helicobacter pylori (strain J99 / ATCC 700824)
Q9KAH3 3.62e-63 203 40 5 287 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P42420 4.62e-63 203 38 2 286 1 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus subtilis (strain 168)
A7ZAH2 6.32e-63 202 37 2 286 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5WKY5 8.69e-59 192 37 3 279 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Shouchella clausii (strain KSM-K16)
P77704 6.01e-56 184 40 7 289 1 ydjI Uncharacterized protein YdjI Escherichia coli (strain K12)
P0A4S2 1.77e-51 173 36 7 299 1 fba Fructose-bisphosphate aldolase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4S1 1.77e-51 173 36 7 299 3 fba Fructose-bisphosphate aldolase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
O83668 3.14e-51 174 33 6 315 3 fba Fructose-bisphosphate aldolase Treponema pallidum (strain Nichols)
Q8YNK2 8.71e-51 173 35 10 321 1 fda Fructose-bisphosphate aldolase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P0CZ59 1.05e-49 169 35 7 300 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XA12 1.05e-49 169 35 7 300 1 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ58 1.05e-49 169 35 7 300 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P68906 1.07e-49 169 35 7 300 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P68905 1.07e-49 169 35 7 300 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M1
Q9XDP3 1.24e-49 171 34 10 329 3 fba Fructose-bisphosphate aldolase Nostoc commune
P47269 2.21e-49 168 35 8 292 3 fba Fructose-bisphosphate aldolase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9I5Y1 3.19e-49 169 34 10 316 3 fba Fructose-bisphosphate aldolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O87796 6.87e-49 168 34 11 316 3 fba Fructose-bisphosphate aldolase Stutzerimonas stutzeri
P75089 8.91e-49 166 34 7 292 3 fba Fructose-bisphosphate aldolase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q56815 2.6e-48 167 34 12 332 1 cbbA Fructose-bisphosphate aldolase Xanthobacter flavus
Q59100 8.2e-48 165 35 11 317 3 cbbAC Fructose-bisphosphate aldolase, chromosomal Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q55664 1.39e-46 162 35 11 328 1 fbaA Fructose-bisphosphate aldolase class 2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q59101 5.21e-46 160 34 11 317 3 cbbAP Fructose-bisphosphate aldolase, plasmid Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9PPP3 3.15e-45 157 35 8 292 3 fba Fructose-bisphosphate aldolase Ureaplasma parvum serovar 3 (strain ATCC 700970)
P29271 3.07e-38 140 29 8 328 3 cfxB Fructose-bisphosphate aldolase 2 Cereibacter sphaeroides
P27995 3.19e-38 140 30 9 330 3 cfxA Fructose-bisphosphate aldolase 1 Cereibacter sphaeroides
P58336 3.61e-36 135 30 10 328 3 cbbA Fructose-bisphosphate aldolase Rhizobium meliloti (strain 1021)
D4GYE0 9.93e-35 130 33 7 262 1 fba Fructose-bisphosphate aldolase class 2 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P56888 7.57e-34 129 30 11 329 3 cbbA Fructose-bisphosphate aldolase Sinorhizobium medicae (strain WSM419)
P0CJ44 1.67e-33 127 35 8 237 1 CIMG_05755 Putative fructose-bisphosphate aldolase Coccidioides immitis (strain RS)
Q9ZEM7 8.58e-22 96 25 9 325 1 fba Fructose-bisphosphate aldolase Streptomyces galbus
P19537 5.82e-21 94 25 9 334 1 fba Fructose-bisphosphate aldolase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P0AB73 6.45e-21 94 26 10 326 3 fbaA Fructose-bisphosphate aldolase class 2 Shigella flexneri
P0AB71 6.45e-21 94 26 10 326 1 fbaA Fructose-bisphosphate aldolase class 2 Escherichia coli (strain K12)
P0AB72 6.45e-21 94 26 10 326 3 fbaA Fructose-bisphosphate aldolase class 2 Escherichia coli O157:H7
O69600 2.66e-20 92 24 6 329 3 fba Fructose-bisphosphate aldolase Mycobacterium leprae (strain TN)
Q9C2U0 7.34e-20 91 26 13 344 3 FBA1 Fructose-bisphosphate aldolase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
P44429 2.71e-19 89 27 11 307 3 fba Fructose-bisphosphate aldolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O52402 4.3e-19 89 25 10 323 3 fba Fructose-bisphosphate aldolase Edwardsiella ictaluri (strain 93-146)
Q89AB6 8.16e-19 88 26 14 310 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9HGY9 1.01e-18 88 25 9 339 2 fbaA Fructose-bisphosphate aldolase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A1VYV7 1.19e-18 87 26 14 328 3 fba Fructose-bisphosphate aldolase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0PAS0 1.25e-18 87 26 14 328 1 fba Fructose-bisphosphate aldolase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9URB4 1.39e-18 87 25 12 354 1 FBA1 Fructose-bisphosphate aldolase Candida albicans (strain SC5314 / ATCC MYA-2876)
P53444 3.95e-18 86 25 10 339 3 fba Fructose-bisphosphate aldolase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q9X8R6 6.54e-18 85 24 7 332 3 fba Fructose-bisphosphate aldolase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8K9B2 8.19e-18 85 26 11 293 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q96UH7 9.84e-18 85 26 12 332 1 FBA1 Fructose-bisphosphate aldolase 1 Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)
P9WQA3 1.35e-17 84 24 9 329 1 fba Fructose-bisphosphate aldolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQA2 1.35e-17 84 24 9 329 3 fba Fructose-bisphosphate aldolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67476 1.35e-17 84 24 9 329 3 fba Fructose-bisphosphate aldolase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P14540 2.83e-17 84 24 9 339 1 FBA1 Fructose-bisphosphate aldolase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O51401 4.39e-17 83 25 13 334 1 fba Fructose-bisphosphate aldolase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P57526 7.32e-16 80 25 8 293 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P36580 4.72e-12 68 26 14 334 1 fba1 Fructose-bisphosphate aldolase Schizosaccharomyces pombe (strain 972 / ATCC 24843)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10570
Feature type CDS
Gene -
Product tagatose bisphosphate family class II aldolase
Location 2326025 - 2326879 (strand: 1)
Length 855 (nucleotides) / 284 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_906
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01116 Fructose-bisphosphate aldolase class-II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0191 Carbohydrate transport and metabolism (G) G Fructose/tagatose bisphosphate aldolase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08302 tagatose 1,6-diphosphate aldolase GatY/KbaY [EC:4.1.2.40] Galactose metabolism
Metabolic pathways		 -

Protein Sequence

MYLVSTRNMLNKAQHENYAVPAFNIHNLETIQVVMETAAEMASPVILAGTPSTFAYAGSDYLISICQQAAEQYRIPVALHLDHHENIPDICNKVISGVRSAMIDASHFPFEENIRLVKEVVNFCHYWDCTVEAELGRLGGQEDDLIVDAKDALFTDPDSAVQFIKATGIDSLAVAIGTAHGMYKHEPHLDFDRLHAIRQKTEIPLVLHGASGIPDTDVRHCIDLGICKVNVATELKIAFSNAIKQYFLDNPDASDPRHYLVPGKAAMKAVVADKIRVCKSDGKL

Flanking regions ( +/- flanking 50bp)

TTTCTTTCGTTTATTATTAATCGTAATTAAACGAAAGATGAGAGGCAAACATGTATCTGGTTTCTACTCGTAATATGCTCAATAAAGCACAGCATGAAAACTATGCTGTGCCCGCTTTTAACATTCATAACTTGGAAACTATCCAAGTGGTAATGGAAACTGCGGCTGAAATGGCATCACCTGTGATCTTAGCAGGCACACCTAGCACGTTTGCTTATGCTGGTAGTGATTATTTAATTTCGATTTGCCAGCAAGCGGCTGAACAATATCGCATCCCAGTAGCACTACATTTAGATCATCATGAAAATATTCCTGATATTTGCAATAAAGTGATTTCGGGGGTGCGATCAGCCATGATCGATGCTTCTCATTTTCCTTTTGAAGAAAACATTCGCCTGGTTAAAGAGGTCGTCAATTTCTGTCATTATTGGGATTGCACCGTAGAAGCTGAATTAGGTCGTCTTGGTGGGCAAGAAGACGATTTAATCGTTGATGCGAAAGATGCGCTATTTACCGATCCTGATTCAGCAGTACAATTTATCAAAGCCACGGGAATTGACTCATTAGCAGTGGCGATTGGTACAGCACATGGTATGTATAAACATGAACCACATCTTGATTTTGATCGTCTACATGCCATCCGCCAAAAAACAGAGATCCCTTTAGTACTACATGGCGCGTCAGGTATTCCTGATACTGATGTACGTCATTGTATCGACTTAGGTATTTGCAAAGTTAACGTAGCAACCGAACTTAAAATTGCTTTCTCTAACGCAATTAAGCAGTACTTTTTAGATAATCCTGATGCCAGTGATCCTCGCCATTATCTAGTGCCAGGTAAAGCGGCGATGAAAGCGGTGGTTGCAGATAAAATTCGCGTCTGTAAAAGTGATGGGAAACTGTGAAAATAAATAGAACTGTCGCCATTATTGGCGAATGTATGATAGAGCTAAGT