Homologs in group_261

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04615 FBDBKF_04615 74.3 Morganella morganii S1 yceI YceI family protein
EHELCC_05905 EHELCC_05905 74.3 Morganella morganii S2 yceI YceI family protein
NLDBIP_06225 NLDBIP_06225 74.3 Morganella morganii S4 yceI YceI family protein
LHKJJB_03105 LHKJJB_03105 74.3 Morganella morganii S3 yceI YceI family protein
HKOGLL_06580 HKOGLL_06580 74.3 Morganella morganii S5 yceI YceI family protein
F4V73_RS08930 F4V73_RS08930 36.3 Morganella psychrotolerans - YceI family protein
F4V73_RS09065 F4V73_RS09065 73.3 Morganella psychrotolerans - YceI family protein

Distribution of the homologs in the orthogroup group_261

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_261

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GD00 5.1e-103 297 72 0 190 3 Spro_1887 UPF0312 protein Spro_1887 Serratia proteamaculans (strain 568)
B7NAT2 3.99e-100 290 70 0 190 3 yceI Protein YceI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q83LI9 4.81e-100 290 70 0 190 3 yceI Protein YceI Shigella flexneri
Q3Z360 5.3e-100 290 70 0 190 3 yceI Protein YceI Shigella sonnei (strain Ss046)
Q31ZB2 5.3e-100 290 70 0 190 3 yceI Protein YceI Shigella boydii serotype 4 (strain Sb227)
P0A8X2 5.3e-100 290 70 0 190 1 yceI Protein YceI Escherichia coli (strain K12)
P0A8X3 5.3e-100 290 70 0 190 3 yceI Protein YceI Escherichia coli O157:H7
Q7N562 5.8e-100 290 74 0 191 3 plu2095 UPF0312 protein plu2095 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4W969 1.41e-99 288 69 0 190 3 Ent638_1570 UPF0312 protein Ent638_1570 Enterobacter sp. (strain 638)
Q8CW58 2.35e-99 288 69 0 190 3 yceI Protein YceI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1JLK0 4.12e-99 287 67 0 190 3 YE1254 UPF0312 protein YE1254 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P61351 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61352 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella typhi
B4TSR8 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella schwarzengrund (strain CVM19633)
B5BBD2 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella paratyphi A (strain AKU_12601)
C0Q852 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella paratyphi C (strain RKS4594)
A9N5Q6 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGX1 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TES8 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella heidelberg (strain SL476)
B5RBE3 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QY08 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella enteritidis PT4 (strain P125109)
B5FL08 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella dublin (strain CT_02021853)
Q57QK1 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella choleraesuis (strain SC-B67)
A9MH07 3.29e-96 280 67 0 190 3 yceI Protein YceI Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4TIX3 4.48e-96 280 65 0 190 3 YPDSF_0829 UPF0312 protein YPDSF_0829 Yersinia pestis (strain Pestoides F)
Q8ZE68 4.48e-96 280 65 0 190 3 YPO2315 UPF0312 protein YPO2315/YP_2102 Yersinia pestis
B2K4S6 4.48e-96 280 65 0 190 3 YPTS_2311 UPF0312 protein YPTS_2311 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66A98 4.48e-96 280 65 0 190 3 YPTB2234 UPF0312 protein YPTB2234 Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R8S1 4.48e-96 280 65 0 190 3 YpAngola_A2224 UPF0312 protein YpAngola_A2224 Yersinia pestis bv. Antiqua (strain Angola)
B1JJW1 4.48e-96 280 65 0 190 3 YPK_1931 UPF0312 protein YPK_1931 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FHR8 4.48e-96 280 65 0 190 3 YpsIP31758_1821 UPF0312 protein YpsIP31758_1821 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B5F951 6.49e-96 279 67 0 190 3 yceI Protein YceI Salmonella agona (strain SL483)
B4T2Y8 2.61e-95 278 66 0 190 3 yceI Protein YceI Salmonella newport (strain SL254)
Q32E67 2.1e-93 273 69 0 181 3 yceI Protein YceI Shigella dysenteriae serotype 1 (strain Sd197)
C6DKU8 2.43e-92 270 67 0 191 3 PC1_2518 UPF0312 protein PC1_2518 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D6A3 7.25e-91 266 65 0 191 3 ECA1782 UPF0312 protein ECA1782 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q02TY9 3.29e-87 257 63 0 191 3 PA14_05510 UPF0312 protein PA14_05510 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9I690 3.29e-87 257 63 0 191 1 PA0423 UPF0312 protein PA0423 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V411 3.29e-87 257 63 0 191 3 PLES_04211 UPF0312 protein PLES_04211 Pseudomonas aeruginosa (strain LESB58)
A6UYN3 3.14e-86 254 62 0 191 3 PSPA7_0523 UPF0312 protein PSPA7_0523 Pseudomonas aeruginosa (strain PA7)
A4XPC6 1.91e-82 245 60 2 192 3 Pmen_0419 UPF0312 protein Pmen_0419 Pseudomonas mendocina (strain ymp)
A4VRG3 2.28e-80 240 60 2 192 3 PST_3941 UPF0312 protein PST_3941 Stutzerimonas stutzeri (strain A1501)
C1DI88 4.68e-79 236 60 1 192 3 Avin_03250 UPF0312 protein Avin_03250 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1I3W0 4.84e-70 214 56 2 192 3 PSEEN5043 UPF0312 protein PSEEN5043 Pseudomonas entomophila (strain L48)
A6WQU7 4.03e-69 211 52 1 191 3 Shew185_3055 UPF0312 protein Shew185_3055 Shewanella baltica (strain OS185)
B8E915 4.03e-69 211 52 1 191 3 Sbal223_1323 UPF0312 protein Sbal223_1323 Shewanella baltica (strain OS223)
Q4ZZ95 5.66e-69 211 58 2 192 3 Psyr_0457 UPF0312 protein Psyr_0457 Pseudomonas syringae pv. syringae (strain B728a)
Q48PB8 5.66e-69 211 58 2 192 3 PSPPH_0448 UPF0312 protein PSPPH_0448 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4K4H3 9.13e-69 211 52 1 196 3 PFL_5802 UPF0312 protein PFL_5802 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A3D710 1.48e-68 210 52 1 191 3 Sbal_3041 UPF0312 protein Sbal_3041 Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q87V70 1.5e-68 210 58 2 192 3 PSPTO_5071 UPF0312 protein PSPTO_5071 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C3K3H1 1.63e-68 210 54 2 192 3 PFLU_5725 UPF0312 protein PFLU_5725 Pseudomonas fluorescens (strain SBW25)
A9KXQ8 2.98e-68 209 52 1 191 3 Sbal195_3198 UPF0312 protein Sbal195_3198 Shewanella baltica (strain OS195)
B1J2Y3 2.18e-67 207 57 2 192 3 PputW619_0484 UPF0312 protein PputW619_0484 Pseudomonas putida (strain W619)
B0KM05 3.48e-67 206 57 2 192 3 PputGB1_5030 UPF0312 protein PputGB1_5030 Pseudomonas putida (strain GB-1)
Q0HXA7 4.06e-67 206 50 1 191 3 Shewmr7_1249 UPF0312 protein Shewmr7_1249 Shewanella sp. (strain MR-7)
A0KUE5 9.51e-67 205 50 1 191 3 Shewana3_1179 UPF0312 protein Shewana3_1179 Shewanella sp. (strain ANA-3)
Q0HL09 1.96e-66 204 50 1 191 3 Shewmr4_1178 UPF0312 protein Shewmr4_1178 Shewanella sp. (strain MR-4)
Q88D47 2.23e-65 202 55 2 192 3 PP_4981 UPF0312 protein PP_4981 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA14 2.23e-65 202 55 2 192 3 Pput_4854 UPF0312 protein Pput_4854 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4Y8Y8 1.55e-63 197 49 1 191 3 Sputcn32_2702 UPF0312 protein Sputcn32_2702 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RHK7 2.08e-63 197 49 1 191 3 Sputw3181_1309 UPF0312 protein Sputw3181_1309 Shewanella sp. (strain W3-18-1)
Q12MB6 4.28e-62 194 54 1 170 3 Sden_2128 UPF0312 protein Sden_2128 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8EBX5 4.92e-58 183 49 1 191 3 SO_3370 UPF0312 protein SO_3370 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A5F0B6 1.21e-53 172 47 2 191 3 VC0395_0473 UPF0312 protein VC0395_0473/VC395_A0785 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87HV6 1.97e-53 171 46 2 191 3 VPA0850 UPF0312 protein VPA0850 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KM50 2.99e-53 171 46 2 191 3 VC_A0539 UPF0312 protein VC_A0539 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LVF6 2.99e-53 171 46 2 191 3 VCM66_A0498 UPF0312 protein VCM66_A0498 Vibrio cholerae serotype O1 (strain M66-2)
Q7MED4 6.84e-53 170 44 2 191 3 VVA0736 UPF0312 protein VVA0736 Vibrio vulnificus (strain YJ016)
Q8D7C6 6.84e-53 170 44 2 191 3 VV2_0231 UPF0312 protein VV2_0231 Vibrio vulnificus (strain CMCP6)
A7N8H5 2.79e-52 169 47 4 194 3 VIBHAR_05924 UPF0312 protein VIBHAR_05924 Vibrio campbellii (strain ATCC BAA-1116)
Q8CTV7 2.85e-17 78 33 2 135 3 SE_0264 UPF0312 protein SE_0264 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HKN0 2.85e-17 78 33 2 135 3 SERP2314 UPF0312 protein SERP2314 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6GDB7 1.51e-15 73 31 3 145 3 SAR2769 UPF0312 protein SAR2769 Staphylococcus aureus (strain MRSA252)
Q2FUS9 2.45e-15 73 31 3 145 3 SAOUHSC_03022 UPF0312 protein SAOUHSC_03022 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HCL0 2.45e-15 73 31 3 145 3 SACOL2711 UPF0312 protein SACOL2711 Staphylococcus aureus (strain COL)
Q2FDH4 2.45e-15 73 31 3 145 3 SAUSA300_2620 UPF0312 protein SAUSA300_2620 Staphylococcus aureus (strain USA300)
Q8NUH6 4.54e-15 72 31 3 145 3 MW2606 UPF0312 protein MW2606 Staphylococcus aureus (strain MW2)
Q6G5Y8 4.54e-15 72 31 3 145 3 SAS2572 UPF0312 protein SAS2572 Staphylococcus aureus (strain MSSA476)
Q99QV4 7.83e-15 72 31 3 145 3 SAV2687 UPF0312 protein SAV2687 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A339 7.83e-15 72 31 3 145 1 SA2479 UPF0312 protein SA2479 Staphylococcus aureus (strain N315)
Q2YZA5 8.08e-15 72 31 3 145 3 SAB2563 UPF0312 protein SAB2563 Staphylococcus aureus (strain bovine RF122 / ET3-1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10440
Feature type CDS
Gene -
Product YceI family protein
Location 2293968 - 2294546 (strand: -1)
Length 579 (nucleotides) / 192 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_261
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF04264 YceI-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2353 General function prediction only (R) R Polyisoprenoid-binding periplasmic protein YceI

Protein Sequence

MFKKALLSLTAGALLFNASSALAADYQIDKQGQHAFVQFRIQHLGYSWLYGTFKDFDGSFTYDKEDPSKDKVDVVIKTGSLDTNHAERDKHLRSADFFNVSKYPEAKFVSTKVTRDGENYTVTGDLTLNGVTKPISLNAKLIGEGTDPWKGYRAGFEATGKVNLKEFNFKSDLGPKSQEAELIISVEGVKKN

Flanking regions ( +/- flanking 50bp)

AATAATTAAATTTATATTACCCTGTTAATAACAATATTATGGAGAGAACAATGTTTAAGAAGGCGTTATTGAGTTTAACTGCAGGTGCATTATTATTTAATGCTAGTTCAGCATTAGCGGCTGATTATCAAATTGATAAACAAGGGCAACATGCTTTTGTGCAATTTCGTATCCAACACTTAGGTTATAGCTGGTTATACGGCACATTTAAAGATTTTGATGGAAGCTTCACTTACGATAAAGAAGATCCTTCAAAAGATAAAGTCGATGTTGTGATTAAAACGGGTAGTTTAGATACTAATCACGCTGAACGTGACAAACACTTACGTAGTGCTGATTTCTTTAACGTCAGTAAATATCCTGAAGCTAAGTTTGTCTCAACCAAAGTGACTCGTGATGGTGAAAATTATACGGTGACGGGTGATTTAACACTTAATGGCGTTACAAAACCAATTTCACTAAATGCAAAATTAATTGGTGAAGGTACTGATCCGTGGAAAGGGTATCGCGCTGGTTTTGAAGCAACAGGTAAAGTTAATCTGAAAGAGTTTAACTTTAAATCAGATTTAGGACCAAAATCGCAAGAAGCAGAATTAATCATCTCTGTTGAAGGTGTGAAAAAAAATTAAACGTAGCGAATATTGGTAAGCAATAATTTGCGATATCACCTAATAGATTA