Homologs in group_877

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04490 FBDBKF_04490 85.3 Morganella morganii S1 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
EHELCC_05780 EHELCC_05780 85.3 Morganella morganii S2 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
NLDBIP_06100 NLDBIP_06100 85.3 Morganella morganii S4 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
LHKJJB_02980 LHKJJB_02980 85.3 Morganella morganii S3 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
HKOGLL_06455 HKOGLL_06455 85.3 Morganella morganii S5 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
F4V73_RS08945 F4V73_RS08945 85.7 Morganella psychrotolerans - acetoin reductase

Distribution of the homologs in the orthogroup group_877

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_877

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q48436 2.5e-96 285 56 0 253 1 budC Diacetyl reductase [(S)-acetoin forming] Klebsiella pneumoniae
Q9ZNN8 4.96e-88 265 55 1 256 1 budC L-2,3-butanediol dehydrogenase Corynebacterium glutamicum
Q5HKG6 1.25e-83 253 49 1 255 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CQD2 1.97e-83 253 49 1 255 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P66776 1.04e-78 241 49 0 256 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain MW2)
Q6GCZ8 1.04e-78 241 49 0 256 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain MSSA476)
Q6GKH9 1.04e-78 241 49 0 256 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain MRSA252)
P99120 1.04e-78 241 49 0 256 1 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain N315)
P66775 1.04e-78 241 49 0 256 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJP2 1.04e-78 241 49 0 256 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain COL)
Q04520 2.24e-70 219 56 0 194 3 budC Diacetyl reductase [(S)-acetoin forming] Raoultella terrigena
A0A2H3D8Y2 1.01e-64 205 45 2 257 1 ARMGADRAFT_1018421 Short-chain dehydrogenase/reductase ARMGADRAFT_1018421 Armillaria gallica
Q59787 2.03e-50 169 36 1 255 1 polS Sorbitol dehydrogenase Cereibacter sphaeroides
A9CES4 1.11e-48 164 39 1 255 1 Atu3164 Galactitol 2-dehydrogenase Agrobacterium fabrum (strain C58 / ATCC 33970)
A0A1V0QSC6 1.08e-46 159 40 3 257 1 eriH Short-chain dehydrogenase/reductase eriH Hericium erinaceus
Q9X248 7.84e-44 151 36 2 257 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P94681 1.5e-43 150 36 4 256 1 tsaC1 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 Comamonas testosteroni
P51831 5.85e-43 149 36 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Bacillus subtilis (strain 168)
C8WGQ3 1.19e-42 149 35 3 255 1 Elen_1325 3beta-hydroxysteroid dehydrogenase 2 Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)
Q949M3 5.01e-41 146 39 5 253 2 bkr3 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic Brassica napus
Q93X62 5.12e-41 146 39 5 253 1 gbkr1 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic Brassica napus
P0A2D1 5.71e-41 144 37 6 256 3 ucpA Oxidoreductase UcpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D2 5.71e-41 144 37 6 256 3 ucpA Oxidoreductase UcpA Salmonella typhi
Q93X67 1.67e-40 145 39 5 253 2 bkr2 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic Brassica napus
Q937L4 1.69e-40 143 35 3 253 1 cpnA Cyclopentanol dehydrogenase Comamonas testosteroni
Q8GAV9 1.69e-40 143 35 3 253 1 cpnA Cyclopentanol dehydrogenase Comamonas sp. (strain NCIMB 9872)
E9ET40 1.07e-39 141 36 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q8XBJ4 1.31e-39 141 36 6 256 3 ucpA Oxidoreductase UcpA Escherichia coli O157:H7
P0A0I0 1.55e-39 140 38 3 252 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain MW2)
Q6G9Y2 1.55e-39 140 38 3 252 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain MSSA476)
Q6GHK4 1.55e-39 140 38 3 252 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain MRSA252)
P99093 1.55e-39 140 38 3 252 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain N315)
P0A0H9 1.55e-39 140 38 3 252 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGK2 1.55e-39 140 38 3 252 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain COL)
P37769 2.57e-39 140 33 3 262 1 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Escherichia coli (strain K12)
P37440 3.09e-39 140 36 6 256 1 ucpA Oxidoreductase UcpA Escherichia coli (strain K12)
Q49117 3.61e-39 139 39 4 255 3 MexAM1_META1p0182 Uncharacterized oxidoreductase MexAM1_META1p0182 Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
A0A0B4GT47 3.8e-39 140 36 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium anisopliae (strain ARSEF 549)
A0A0B4FP77 5.89e-39 139 36 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium brunneum (strain ARSEF 3297)
A0A0B4HVU2 1.52e-38 138 36 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium majus (strain ARSEF 297)
A0A0B4GU97 2.63e-38 137 36 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium guizhouense (strain ARSEF 977)
P33207 2.77e-38 139 38 5 253 1 At1g24360 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic Arabidopsis thaliana
P28643 3.08e-38 139 36 4 257 2 CLKR27 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic Cuphea lanceolata
Q00791 6.36e-38 136 35 6 261 2 stcU Versicolorin reductase stcU Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8CPI3 6.44e-38 136 37 3 252 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPW0 6.44e-38 136 37 3 252 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5FPE5 8.19e-38 136 36 3 256 1 GOX2015 Glucose 1-dehydrogenase Gluconobacter oxydans (strain 621H)
I6YCF0 9.78e-38 136 35 4 250 1 ipdF (5R,7aS)-5-hydroxy-7a-methyl-1-oxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
E9EHG1 1.68e-37 135 36 4 258 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium acridum (strain CQMa 102)
Q949M2 2.94e-37 134 37 6 253 2 bkr4 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) Brassica napus
Q05528 5.04e-37 134 33 2 257 1 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Dickeya dadantii (strain 3937)
Q6TMA3 5.71e-37 134 36 9 279 1 chnA Cyclohexanol dehydrogenase Rhodococcus sp. (strain TK6)
Q9KJF1 1.36e-36 132 34 5 257 1 bbsD (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD Thauera aromatica
A0A411PQN6 1.46e-36 133 33 5 257 3 AgnL6 Short chain dehydrogenase AgnL6 Paecilomyces divaricatus
P9WGT1 2.16e-36 132 37 4 257 1 fabG3 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P69166 2.16e-36 132 37 4 257 3 fabG3 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGT0 3.6e-36 132 37 4 257 3 fabG3 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9F7E0 4.27e-36 131 35 4 253 1 chnA Cyclohexanol dehydrogenase Acinetobacter sp. (strain SE19)
O67610 5.87e-36 131 33 3 257 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Aquifex aeolicus (strain VF5)
P50161 6.51e-36 131 34 6 261 1 aflM Versicolorin reductase 1 Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
Q93X68 8.11e-36 132 36 5 252 2 bkr1 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) Brassica napus
Q5TJF5 8.88e-36 131 34 4 264 3 HSD17B8 (3R)-3-hydroxyacyl-CoA dehydrogenase Canis lupus familiaris
Q15SS0 2.7e-35 129 35 4 263 1 Patl_2552 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A7AZH2 2.94e-35 130 34 6 267 1 RUMGNA_00694 3beta-hydroxysteroid dehydrogenase Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)
P87025 4.85e-35 129 32 5 257 3 THR1 Trihydroxynaphthalene reductase Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)
P80873 5.21e-35 129 35 5 255 1 ydaD General stress protein 39 Bacillus subtilis (strain 168)
H9XP47 6.96e-35 128 34 7 259 1 budC Meso-2,3-butanediol dehydrogenase Serratia marcescens
Q92506 1e-34 128 32 3 262 1 HSD17B8 (3R)-3-hydroxyacyl-CoA dehydrogenase Homo sapiens
P39483 1.04e-34 128 31 4 256 3 gdhII Glucose 1-dehydrogenase 2 Priestia megaterium
W3XC32 1.12e-34 129 32 5 257 2 Pfmaj Trihydroxynaphthalene reductase PfmaI Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q8JZV9 1.7e-34 127 35 8 254 1 Bdh2 Dehydrogenase/reductase SDR family member 6 Mus musculus
O31680 4.25e-34 126 33 4 254 3 ykvO Uncharacterized oxidoreductase YkvO Bacillus subtilis (strain 168)
Q9WYG0 5.2e-34 126 32 4 256 3 TM_0325 Uncharacterized oxidoreductase TM_0325 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P66782 6.02e-34 125 32 4 255 3 fabG2 Uncharacterized oxidoreductase Mb1385 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGR9 6.02e-34 125 32 4 255 1 fabG2 Uncharacterized oxidoreductase Rv1350 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGR8 6.02e-34 125 32 4 255 3 fabG2 Uncharacterized oxidoreductase MT1393 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q3KPT7 1.05e-33 125 36 8 255 2 bdh2 Dehydrogenase/reductase SDR family member 6 Xenopus laevis
P50842 1.57e-33 125 35 7 262 2 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Bacillus subtilis (strain 168)
P72332 1.79e-33 124 33 3 254 3 nodG Nodulation protein G Rhizobium sp. (strain N33)
P50199 1.81e-33 125 31 3 258 1 gno Gluconate 5-dehydrogenase Gluconobacter oxydans (strain 621H)
A0A384JQF5 1.94e-33 125 36 6 255 2 aba4 Short-chain dehydrogenase/reductase aba4 Botryotinia fuckeliana (strain B05.10)
P39640 2.08e-33 124 34 4 256 1 bacC Dihydroanticapsin 7-dehydrogenase Bacillus subtilis (strain 168)
P41177 2.89e-33 124 36 3 255 3 None Monensin polyketide synthase putative ketoacyl reductase Streptomyces virginiae
P12310 2.93e-33 124 31 5 256 2 gdh Glucose 1-dehydrogenase Bacillus subtilis (strain 168)
Q9RA05 2.96e-33 125 35 6 275 1 limC (-)-trans-carveol dehydrogenase Rhodococcus erythropolis
Q5BH34 3.05e-33 124 31 4 256 1 mdpC Short chain dehydrogenase mdpC Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P39484 3.05e-33 124 30 3 255 3 gdhIII Glucose 1-dehydrogenase 3 Priestia megaterium
A0A1L9WLH9 3.42e-33 124 31 5 262 1 AacuN Short chain dehydrogenase/reductase AacuN Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
P39485 3.58e-33 124 30 3 255 1 gdhIV Glucose 1-dehydrogenase 4 Priestia megaterium
P10528 4.06e-33 124 30 3 255 3 gdhA Glucose 1-dehydrogenase A Priestia megaterium
Q988B7 5.81e-33 123 34 5 257 1 pldh-t Pyridoxal 4-dehydrogenase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q45219 6.31e-33 124 32 4 259 3 blr2146 Probable short-chain type dehydrogenase/reductase blr2146 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
F9XMW6 7.95e-33 123 33 6 260 3 MYCGRDRAFT_87994 Probable tetrahydroxynaphthalene reductase MYCGRDRAFT_87994 Zymoseptoria tritici (strain CBS 115943 / IPO323)
P40288 8.45e-33 123 30 3 255 1 None Glucose 1-dehydrogenase Priestia megaterium
O54438 8.76e-33 122 33 2 256 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5P5I4 1.08e-32 122 35 4 256 1 ped (S)-1-Phenylethanol dehydrogenase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
P40398 1.18e-32 124 34 5 260 3 yhxD Uncharacterized oxidoreductase YhxD Bacillus subtilis (strain 168)
Q14RS1 1.2e-32 122 36 6 255 2 aba4 Short-chain dehydrogenase/reductase aba4 Botryotinia fuckeliana
A7B3K3 1.47e-32 122 31 3 256 1 baiA 3alpha-hydroxysteroid dehydrogenase Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)
E9QUT3 1.52e-32 123 32 4 253 3 arp2 Hydroxynaphthalene reductase arp2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q12634 1.54e-32 123 32 7 264 1 MGG_02252 Tetrahydroxynaphthalene reductase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P17611 2.02e-32 122 34 3 258 3 nodG Nodulation protein G Azospirillum brasilense
P50163 2.03e-32 122 32 4 256 1 TR2 Tropinone reductase 2 Datura stramonium
P50164 2.91e-32 122 33 5 260 2 TR2 Tropinone reductase 2 Hyoscyamus niger
P0DXE0 3.4e-32 121 34 4 256 1 chcB1 Trans-4-hydroxycyclohexanecarboxylate dehydrogenase Corynebacterium cyclohexanicum
M1W270 3.67e-32 121 30 5 261 2 CPUR_05429 Short chain dehydrogenase CPUR_05429 Claviceps purpurea (strain 20.1)
M2WJF1 3.7e-32 121 32 6 261 2 ver1 Versicolorin reductase 1 Dothistroma septosporum (strain NZE10 / CBS 128990)
Q8TFD5 3.7e-32 121 32 6 261 2 ver1 Versicolorin reductase 1 Dothistroma septosporum
Q9URX0 4.43e-32 121 33 7 260 3 SPAC922.06 Uncharacterized oxidoreductase C922.06 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A7DY56 5.28e-32 121 31 4 257 1 TR Tropinone reductase Cochlearia officinalis
D4A1J4 5.29e-32 120 35 8 254 1 Bdh2 Dehydrogenase/reductase SDR family member 6 Rattus norvegicus
P55541 5.31e-32 121 32 4 259 3 NGR_a02730 Uncharacterized short-chain type dehydrogenase/reductase y4lA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P9WGQ9 5.51e-32 120 34 5 260 1 Rv0769 Uncharacterized oxidoreductase Rv0769 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGQ8 5.51e-32 120 34 5 260 3 MT0793 Uncharacterized oxidoreductase MT0793 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9Z8P2 5.63e-32 120 32 4 259 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Chlamydia pneumoniae
Q75KH3 6.16e-32 122 31 6 270 2 Os05g0140800 Glucose and ribitol dehydrogenase homolog Oryza sativa subsp. japonica
P06234 6.75e-32 120 32 3 254 3 nodG Nodulation protein G Rhizobium meliloti (strain 1021)
P39482 9.75e-32 120 29 3 255 2 gdhI Glucose 1-dehydrogenase 1 Priestia megaterium
Q3T046 9.89e-32 120 35 7 255 2 BDH2 Dehydrogenase/reductase SDR family member 6 Bos taurus
A0A5B8YU81 1.07e-31 120 33 7 263 2 GME11373 Short-chain dehydrogenase/reductase GME11373 Pestalotiopsis microspora
C1C4R8 1.46e-31 119 34 8 255 2 bdh2 Dehydrogenase/reductase SDR family member 6 Aquarana catesbeiana
A0A1L5BUG8 1.52e-31 119 34 5 258 3 linB 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)
P46331 1.63e-31 120 33 6 260 3 yxbG Uncharacterized oxidoreductase YxbG Bacillus subtilis (strain 168)
Q561X9 2.83e-31 119 34 8 255 2 bdh2 Dehydrogenase/reductase SDR family member 6 Danio rerio
A0A4P8DJW8 3.27e-31 119 30 5 261 3 dmxR18 Short chain dehydrogenase/reductase dmxR18 Cryptosporiopsis sp. (strain 8999)
A0A2I1C3T5 3.64e-31 119 31 5 261 1 nsrJ Short chain dehydrogenase/reductase nsrJ Aspergillus novofumigatus (strain IBT 16806)
P80869 3.71e-31 119 30 4 257 1 ycdF Glucose 1-dehydrogenase 2 Bacillus subtilis (strain 168)
Q9LBG2 3.93e-31 119 31 4 253 1 lvr Levodione reductase Leifsonia aquatica
Q6MGB5 4.23e-31 119 35 4 267 1 Hsd17b8 (3R)-3-hydroxyacyl-CoA dehydrogenase Rattus norvegicus
P38004 4.44e-31 118 31 3 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P23238 4.46e-31 118 32 4 253 3 phaB Acetoacetyl-CoA reductase Shinella zoogloeoides
Q9ZW04 4.47e-31 119 31 4 256 3 At2g29170 Tropinone reductase homolog At2g29170 Arabidopsis thaliana
A7IQH5 5.02e-31 118 33 4 240 1 xecE3 2-(S)-hydroxypropyl-CoM dehydrogenase 3 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P0CU75 5.63e-31 119 32 7 264 1 claC Short chain dehydrogenase claC Passalora fulva
Q9X6U2 6.17e-31 118 35 6 259 3 hbdH1 D-beta-hydroxybutyrate dehydrogenase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P0DXE1 6.59e-31 118 34 5 251 1 chcB2 Cis-4-hydroxycyclohexanecarboxylate dehydrogenase Corynebacterium cyclohexanicum
D4YYG1 7.19e-31 118 35 5 257 1 linC 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)
Q9PKF7 7.23e-31 118 31 3 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Chlamydia muridarum (strain MoPn / Nigg)
Q9KQH7 7.39e-31 117 32 5 261 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8KWT4 7.47e-31 118 32 4 256 1 bacC Dihydroanticapsin 7-dehydrogenase Bacillus subtilis
P50205 9.46e-31 117 33 4 250 3 phaB Acetoacetyl-CoA reductase Rhizobium meliloti (strain 1021)
Q21929 1.12e-30 117 34 5 255 1 dhs-21 L-xylulose reductase Caenorhabditis elegans
Q8JIS3 1.29e-30 117 32 5 264 1 DER D-erythrulose reductase Gallus gallus
B0ZT44 1.47e-30 117 33 6 260 2 RDT1 Elsinochrome reductase 1 Elsinoe fawcettii
P0A9P9 1.55e-30 117 30 2 257 1 idnO 5-keto-D-gluconate 5-reductase Escherichia coli (strain K12)
P0A9Q0 1.55e-30 117 30 2 257 3 idnO 5-keto-D-gluconate 5-reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P73574 1.63e-30 117 35 4 258 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9ZW03 1.78e-30 117 31 6 259 1 At2g29150 Tropinone reductase homolog At2g29150 Arabidopsis thaliana
Q10216 1.8e-30 117 32 7 255 3 SPAC4H3.08 Uncharacterized oxidoreductase C4H3.08 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9LHT0 3.23e-30 116 33 4 256 2 At5g06060 Tropinone reductase homolog At5g06060 Arabidopsis thaliana
P42317 4.04e-30 116 30 2 254 3 yxjF Uncharacterized oxidoreductase YxjF Bacillus subtilis (strain 168)
Q6P0H7 4.3e-30 115 33 4 251 2 cbr4 Carbonyl reductase family member 4 Danio rerio
Q08632 4.42e-30 116 31 8 269 2 None Short-chain type dehydrogenase/reductase Picea abies
P07772 4.76e-30 116 36 8 256 3 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O07575 5.26e-30 116 33 8 262 3 yhdF Uncharacterized oxidoreductase YhdF Bacillus subtilis (strain 168)
P16544 6.74e-30 115 31 4 261 1 actIII Putative ketoacyl reductase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9ZW18 6.87e-30 115 32 4 256 1 SAG13 Senescence-associated protein 13 Arabidopsis thaliana
P0DKI3 7.3e-30 115 33 4 257 1 At1g07440 Tropinone reductase homolog At1g07440 Arabidopsis thaliana
P33368 7.88e-30 115 30 2 253 1 yohF Uncharacterized oxidoreductase YohF Escherichia coli (strain K12)
P0AG84 9.64e-30 116 33 4 256 1 yghA Uncharacterized oxidoreductase YghA Escherichia coli (strain K12)
P0AG85 9.64e-30 116 33 4 256 3 yghA Uncharacterized oxidoreductase YghA Escherichia coli O157:H7
Q6WVP7 1.45e-29 114 32 5 260 1 adh NADP-dependent (R)-specific alcohol dehydrogenase Lentilactobacillus kefiri
P40397 2.08e-29 115 32 9 264 3 yhxC Uncharacterized oxidoreductase YhxC Bacillus subtilis (strain 168)
Q56840 2.56e-29 114 32 6 255 1 xecD1 2-(R)-hydroxypropyl-CoM dehydrogenase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
C8WJW0 3.27e-29 114 32 5 256 1 Elen_0198 3beta-hydroxysteroid dehydrogenase 1 Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)
Q9L9F8 3.42e-29 114 34 3 250 1 novJ Short-chain reductase protein NovJ Streptomyces niveus
P0C622 4.12e-29 113 29 3 256 3 cmtB 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase Pseudomonas putida
A5W4G5 4.12e-29 113 29 3 256 3 cmtB 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8NUV9 5.48e-29 112 35 3 190 3 MW2403 Uncharacterized oxidoreductase MW2403 Staphylococcus aureus (strain MW2)
Q6G6J1 5.48e-29 112 35 3 190 3 SAS2370 Uncharacterized oxidoreductase SAS2370 Staphylococcus aureus (strain MSSA476)
Q5KTS5 6.3e-29 114 31 5 263 2 CAISE5 Glucose and ribitol dehydrogenase Daucus carota
Q8WNV7 7.9e-29 113 30 6 262 1 DHRS4 Dehydrogenase/reductase SDR family member 4 Sus scrofa
P19337 8.5e-29 112 34 8 262 1 baiA2 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 2 Clostridium scindens (strain JCM 10418 / VPI 12708)
P16542 9.94e-29 113 34 1 232 3 gra-orf5 Granaticin polyketide synthase putative ketoacyl reductase 1 Streptomyces violaceoruber
Q99LB2 1.05e-28 113 31 6 262 1 Dhrs4 Dehydrogenase/reductase SDR family member 4 Mus musculus
P07914 1.09e-28 112 33 8 262 1 baiA1 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 1/3 Clostridium scindens (strain JCM 10418 / VPI 12708)
P07999 1.22e-28 112 30 7 259 1 gdhB Glucose 1-dehydrogenase B Priestia megaterium
D4Z260 1.5e-28 112 33 2 253 1 linX 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)
A0A1L5BU05 1.5e-28 112 33 2 253 3 linX 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)
F4IKM1 1.59e-28 113 32 5 257 2 At2g29340 Tropinone reductase homolog At2g29340 Arabidopsis thaliana
A3LZU7 1.82e-28 112 35 5 259 1 DHG2 L-rhamnose-1-dehydrogenase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q89AG9 1.92e-28 111 28 5 260 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A0A1A9TAK5 2.04e-28 111 31 5 258 1 NR Noroxomaritidine/norcraugsodine reductase Narcissus pseudonarcissus
A0A1C9II22 2.04e-28 111 31 5 258 1 NR Noroxomaritidine/norcraugsodine reductase Narcissus aff. pseudonarcissus MK-2014
Q2FVD5 2.19e-28 110 35 3 190 3 SAOUHSC_02778 Uncharacterized oxidoreductase SAOUHSC_02778 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HD73 2.19e-28 110 35 3 190 3 SACOL2488 Uncharacterized oxidoreductase SACOL2488 Staphylococcus aureus (strain COL)
Q2FE21 2.19e-28 110 35 3 190 3 SAUSA300_2422 Uncharacterized oxidoreductase SAUSA300_2422 Staphylococcus aureus (strain USA300)
Q99RF5 2.21e-28 110 35 3 190 3 SAV2478 Uncharacterized oxidoreductase SAV2478 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A3L9 2.21e-28 110 35 3 190 1 SA2266 Uncharacterized oxidoreductase SA2266 Staphylococcus aureus (strain N315)
P50941 3.59e-28 110 31 5 257 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia prowazekii (strain Madrid E)
A0A3Q8GL18 3.65e-28 111 29 5 260 1 NEPS1 (+)-cis,trans-nepetalactol synthase NEPS1 Nepeta racemosa
P05707 4.83e-28 110 31 3 255 1 srlD Sorbitol-6-phosphate 2-dehydrogenase Escherichia coli (strain K12)
A0R518 6.69e-28 110 31 5 276 1 MSMEG_6031 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P14802 8.48e-28 109 37 2 177 3 yoxD Uncharacterized oxidoreductase YoxD Bacillus subtilis (strain 168)
P55336 8.56e-28 109 31 4 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Vibrio harveyi
Q9ZW19 9.99e-28 110 30 4 257 1 SDR Tropinone reductase homolog At2g29360 Arabidopsis thaliana
Q92EU6 1.28e-27 109 31 6 257 1 golD NAD-dependent glycerol dehydrogenase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9ZW20 1.3e-27 110 30 5 257 3 At2g29370 Tropinone reductase homolog At2g29370 Arabidopsis thaliana
Q9ZW14 1.33e-27 109 32 5 257 2 At2g29310 Tropinone reductase homolog At2g29310 Arabidopsis thaliana
Q9SQR2 1.33e-27 110 31 8 271 1 ChlADR2 NADPH-dependent aldehyde reductase 2, chloroplastic Arabidopsis thaliana
Q5C9I9 1.6e-27 109 31 5 257 1 None (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial Mentha piperita
Q8P3K4 1.78e-27 110 34 6 254 1 XCC4067 2-keto-3-deoxy-L-fuconate dehydrogenase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9SQR4 1.95e-27 109 31 7 270 3 At3g03980 NADPH-dependent aldehyde reductase-like protein, chloroplastic Arabidopsis thaliana
Q9GKX2 1.97e-27 109 30 4 261 1 DHRS4 Dehydrogenase/reductase SDR family member 4 (Fragment) Oryctolagus cuniculus
Q1JP75 2.03e-27 108 31 4 261 2 DCXR L-xylulose reductase Bos taurus
O86034 2.67e-27 108 32 6 262 1 bdhA D-beta-hydroxybutyrate dehydrogenase Rhizobium meliloti (strain 1021)
Q6GDV6 3.03e-27 108 34 3 190 3 SAR2567 Uncharacterized oxidoreductase SAR2567 Staphylococcus aureus (strain MRSA252)
P43713 3.77e-27 108 31 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P50162 3.77e-27 108 31 6 262 1 TR1 Tropinone reductase 1 Datura stramonium
F1SWA0 4.11e-27 108 32 3 258 1 ZSD1 Zerumbone synthase Zingiber zerumbet
A0A1U8QWA2 4.41e-27 113 35 2 210 1 ATRR Glycine betaine reductase ATRR Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9ZW13 4.43e-27 108 30 4 256 2 At2g29290 Tropinone reductase homolog At2g29290 Arabidopsis thaliana
Q53217 4.75e-27 112 34 5 252 3 NGR_a01150 Uncharacterized short-chain type dehydrogenase/reductase y4vI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q53217 6.5e-14 74 25 6 255 3 NGR_a01150 Uncharacterized short-chain type dehydrogenase/reductase y4vI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8SPU8 5.65e-27 108 31 4 254 2 DHRS4 Dehydrogenase/reductase SDR family member 4 Bos taurus
W3XAA0 5.78e-27 108 35 5 257 1 PfmaG Tetrahydroxynaphthalene reductase PfmaG Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q9ZW16 6.12e-27 108 33 5 260 1 TRI Tropinone reductase homolog At2g29330 Arabidopsis thaliana
P50204 6.37e-27 107 33 5 243 3 phaB Acetoacetyl-CoA reductase Paracoccus denitrificans
Q9C826 7.28e-27 108 33 6 262 1 ABA2 Xanthoxin dehydrogenase Arabidopsis thaliana
Q91X52 7.56e-27 107 30 4 261 1 Dcxr L-xylulose reductase Mus musculus
O80714 7.79e-27 107 32 7 259 3 SDR3c Short-chain dehydrogenase reductase 3c Arabidopsis thaliana
P55575 9.1e-27 107 32 6 263 3 NGR_a02430 Uncharacterized short-chain type dehydrogenase/reductase y4mP Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P50171 1.03e-26 107 34 3 264 1 Hsd17b8 (3R)-3-hydroxyacyl-CoA dehydrogenase Mus musculus
O49332 1.2e-26 107 31 4 256 3 At2g30670 Tropinone reductase homolog At2g30670 Arabidopsis thaliana
A0A2U8U2K8 1.26e-26 107 30 5 254 1 asL5 Oxidoreductase asL5 Sarocladium schorii
Q91XV4 1.3e-26 106 31 3 257 1 DCXR L-xylulose reductase Mesocricetus auratus
P0DOV5 1.45e-26 107 31 5 259 1 PpSQ1_00405 Sulfoquinovose 1-dehydrogenase Pseudomonas putida
C0KTJ6 1.46e-26 107 32 7 258 1 None Galactitol 2-dehydrogenase (L-tagatose-forming) Cereibacter sphaeroides
Q920P0 1.83e-26 106 30 4 261 1 Dcxr L-xylulose reductase Rattus norvegicus
Q8VID1 1.9e-26 107 30 6 265 2 Dhrs4 Dehydrogenase/reductase SDR family member 4 Rattus norvegicus
Q94KL7 1.96e-26 107 31 8 257 1 None Secoisolariciresinol dehydrogenase (Fragment) Forsythia intermedia
H9BFQ2 2.13e-26 106 31 7 262 2 None Tropinone reductase-like 3 Erythroxylum coca
P25145 2.26e-26 106 33 7 248 3 lmo0432 Uncharacterized oxidoreductase Lmo0432 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q42182 2.79e-26 106 30 5 257 2 At2g29300 Tropinone reductase homolog At2g29300 Arabidopsis thaliana
Q6CEE9 3e-26 106 31 8 267 1 YALI0B16192g Probable NADP-dependent mannitol dehydrogenase Yarrowia lipolytica (strain CLIB 122 / E 150)
Q9Y6Z9 3.59e-26 105 34 7 264 3 sou1 Sorbose reductase sou1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P9WGS3 3.74e-26 110 32 2 230 1 ephD Probable oxidoreductase EphD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGS2 3.74e-26 110 32 2 230 3 ephD Probable oxidoreductase EphD Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66778 3.74e-26 110 32 2 230 3 ephD Probable oxidoreductase EphD Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8K9J5 3.77e-26 105 27 4 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q91VT4 4.37e-26 105 33 5 251 1 Cbr4 3-oxoacyl-[acyl-carrier-protein] reductase Mus musculus
Q9ZW15 4.46e-26 105 31 5 257 2 At2g29320 Tropinone reductase homolog At2g29320 Arabidopsis thaliana
P0A2C9 5e-26 105 30 6 260 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D0 5e-26 105 30 6 260 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Salmonella typhi
O34717 6.46e-26 105 27 3 258 2 fadH Probable 2,4-dienoyl-CoA reductase [(2E)-enoyl-CoA-producing] Bacillus subtilis (strain 168)
Q8KWS9 6.95e-26 105 32 6 258 1 bacC Dihydroanticapsin 7-dehydrogenase Bacillus amyloliquefaciens
P08074 6.99e-26 104 33 5 259 1 Cbr2 Carbonyl reductase [NADPH] 2 Mus musculus
Q8RX32 7.02e-26 105 31 7 260 2 At1g07450 Tropinone reductase homolog At1g07450 Arabidopsis thaliana
Q9HK58 7.32e-26 105 29 4 261 1 rhaD L-rhamnose 1-dehydrogenase (NADP(+)) Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q9BUT1 7.45e-26 104 33 7 254 1 BDH2 Dehydrogenase/reductase SDR family member 6 Homo sapiens
Q9SCU0 9.7e-26 105 30 5 265 3 SDR2a Short-chain dehydrogenase reductase 2a Arabidopsis thaliana
P19871 1.01e-25 104 33 5 260 1 None 3-beta-hydroxysteroid dehydrogenase Comamonas testosteroni
P95727 1.38e-25 104 30 7 256 1 chcA 1-cyclohexenylcarbonyl-CoA reductase Streptomyces collinus
P0AEK3 1.43e-25 103 31 6 261 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Shigella flexneri
P0AEK2 1.43e-25 103 31 6 261 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Escherichia coli (strain K12)
P9WGS7 1.45e-25 104 31 3 269 1 Rv0687 Uncharacterized NAD-dependent oxidoreductase Rv0687 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGS6 1.45e-25 104 31 3 269 3 MT0715 Uncharacterized NAD-dependent oxidoreductase MT0715 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6NV34 1.48e-25 105 31 5 256 2 decr2 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] Danio rerio
Q5RCF8 1.56e-25 104 30 5 262 2 DHRS4 Dehydrogenase/reductase SDR family member 4 Pongo abelii
A0A8F5XX49 1.66e-25 104 32 9 267 1 BDH2 (+)-borneol dehydrogenase 2 Salvia officinalis
Q7TS56 1.88e-25 103 33 5 251 2 Cbr4 3-oxoacyl-[acyl-carrier-protein] reductase Rattus norvegicus
P39071 2.04e-25 103 32 6 258 1 dhbA 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Bacillus subtilis (strain 168)
P50165 2.32e-25 103 30 4 259 2 None Tropinone reductase homolog Datura stramonium
Q9ZW12 2.7e-25 105 28 5 260 2 At2g29260 Tropinone reductase homolog At2g29260, chloroplastic Arabidopsis thaliana
Q92EK7 2.73e-25 103 31 6 247 3 lin0452 Uncharacterized oxidoreductase Lin0452 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q920N9 3.03e-25 103 30 4 261 2 DCXR L-xylulose reductase Cavia porcellus
W6QDA7 3.1e-25 103 30 8 275 1 anuF Short-chain dehydrogenase anuF Penicillium roqueforti (strain FM164)
O18404 3.23e-25 103 34 4 205 1 scu 3-hydroxyacyl-CoA dehydrogenase type-2 Drosophila melanogaster
O93868 3.5e-25 103 29 3 258 1 mtdH NADP-dependent mannitol dehydrogenase Agaricus bisporus
Q51576 3.9e-25 103 32 7 258 3 PA3106 Uncharacterized oxidoreductase PA3106 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WGT3 4.03e-25 102 32 6 251 1 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGT2 4.03e-25 102 32 6 251 3 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Y5 4.03e-25 102 32 6 251 3 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5NVG2 4.04e-25 103 29 2 192 2 HSD17B11 Estradiol 17-beta-dehydrogenase 11 Pongo abelii
Q5HLD8 4.19e-25 102 33 3 188 3 SERP2049 Uncharacterized oxidoreductase SERP2049 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN40 4.19e-25 102 33 3 188 3 SE_2036 Uncharacterized oxidoreductase SE_2036 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9BTZ2 4.27e-25 103 29 5 262 1 DHRS4 Dehydrogenase/reductase SDR family member 4 Homo sapiens
G4N1P8 4.42e-25 103 30 5 259 2 ABA4 Short-chain dehydrogenase/reductase ABA4 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
L7I518 4.42e-25 103 30 5 259 2 ABA4 Short-chain dehydrogenase/reductase ABA4 Pyricularia oryzae (strain Y34)
Q7Z4W1 4.42e-25 102 29 4 257 1 DCXR L-xylulose reductase Homo sapiens
P70720 4.46e-25 102 30 4 253 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Aggregatibacter actinomycetemcomitans
P37694 4.5e-25 103 30 6 252 3 hetN Ketoacyl reductase HetN Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q6NUE2 4.73e-25 102 30 6 253 2 cbr4 Carbonyl reductase family member 4 Xenopus laevis
Q8NBQ5 6.5e-25 103 29 2 192 1 HSD17B11 Estradiol 17-beta-dehydrogenase 11 Homo sapiens
O31642 7.94e-25 102 30 8 259 3 yjdA Uncharacterized oxidoreductase YjdA Bacillus subtilis (strain 168)
O34782 8.13e-25 102 30 5 263 3 yvrD Uncharacterized oxidoreductase YvrD Bacillus subtilis (strain 168)
Q68VY7 1.03e-24 101 30 5 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q8N4T8 1.18e-24 101 33 5 251 1 CBR4 3-oxoacyl-[acyl-carrier-protein] reductase Homo sapiens
T2KLZ8 1.18e-24 102 29 5 258 2 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
A4IFA7 1.23e-24 101 32 5 251 2 CBR4 3-oxoacyl-[acyl-carrier-protein] reductase Bos taurus
Q2UEK6 1.34e-24 101 30 4 260 2 astEA Short chain dehydrogenase/reductase astE Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q73SC8 1.45e-24 102 31 3 267 1 MAP_4146 Uncharacterized NAD-dependent oxidoreductase MAP_4146 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q7Z5P4 1.5e-24 102 27 3 218 1 HSD17B13 17-beta-hydroxysteroid dehydrogenase 13 Homo sapiens
O80713 1.53e-24 101 30 5 263 2 SDR3a Short-chain dehydrogenase reductase 3a Arabidopsis thaliana
O74470 1.69e-24 101 29 4 257 3 SPCC1739.08c Uncharacterized oxidoreductase C1739.08c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q56841 1.76e-24 101 32 6 257 1 xecE1 2-(S)-hydroxypropyl-CoM dehydrogenase 1 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q4L8Y1 2.24e-24 100 32 2 190 3 SH0585 Uncharacterized oxidoreductase SH0585 Staphylococcus haemolyticus (strain JCSC1435)
Q9MA93 2.58e-24 101 28 5 263 2 At3g05260 Glucose and ribitol dehydrogenase homolog 2 Arabidopsis thaliana
G5EGA6 2.65e-24 100 30 6 265 1 dhrs-4 Dehydrogenase/reductase SDR family member 4 Caenorhabditis elegans
Q92RN6 3.01e-24 100 29 4 259 3 galD Probable galactose dehydrogenase GalD Rhizobium meliloti (strain 1021)
Q6AYS8 3.02e-24 101 29 2 189 2 Hsd17b11 Estradiol 17-beta-dehydrogenase 11 Rattus norvegicus
G9FRD7 3.39e-24 100 31 6 259 1 hdha 7alpha-hydroxysteroid dehydrogenase Clostridium sardiniense
Q4JK73 4.48e-24 101 28 2 189 2 HSD17B11 Estradiol 17-beta-dehydrogenase 11 Macaca fascicularis
Q5M875 5.86e-24 100 31 3 190 1 Hsd17b13 17-beta-hydroxysteroid dehydrogenase 13 Rattus norvegicus
P71534 7.93e-24 99 30 5 255 1 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q4A054 8.66e-24 99 32 3 193 3 SSP0419 Uncharacterized oxidoreductase SSP0419 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9BY49 9.59e-24 100 26 5 265 1 PECR Peroxisomal trans-2-enoyl-CoA reductase Homo sapiens
P45375 1.15e-23 99 30 3 253 3 phaB Acetoacetyl-CoA reductase Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
A0A3Q8GYY4 1.42e-23 99 32 10 265 1 NEPS2 (+)-cis,trans-nepetalactol synthase NEPS2 Nepeta racemosa
Q5LA59 1.46e-23 99 30 6 258 1 hdhA 7alpha-hydroxysteroid dehydrogenase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q9FZ42 1.48e-23 99 29 6 264 1 ChlADR1 NADPH-dependent aldehyde reductase 1, chloroplastic Arabidopsis thaliana
F4J300 1.72e-23 99 31 5 261 3 SDR5 Short-chain dehydrogenase reductase 5 Arabidopsis thaliana
Q1NEI6 2.01e-23 98 29 6 253 1 LRA5 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)) Sphingomonas sp. (strain SKA58)
Q8VCR2 2.11e-23 99 30 3 193 1 Hsd17b13 17-beta-hydroxysteroid dehydrogenase 13 Mus musculus
P76633 2.2e-23 98 28 3 259 3 ygcW Uncharacterized oxidoreductase YgcW Escherichia coli (strain K12)
Q49WS9 2.26e-23 98 33 4 206 3 SSP1627 Uncharacterized oxidoreductase SSP1627 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P73826 2.39e-23 98 31 5 255 1 phaB Acetoacetyl-CoA reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P87219 2.54e-23 99 30 8 265 1 SOU1 Sorbose reductase SOU1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q29529 2.93e-23 97 29 4 255 1 CBR2 Carbonyl reductase [NADPH] 2 Sus scrofa
Q9WVK3 4.04e-23 98 27 7 266 2 Pecr Peroxisomal trans-2-enoyl-CoA reductase Rattus norvegicus
P19992 4.18e-23 97 32 6 254 1 None 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Streptomyces exfoliatus
P50160 4.22e-23 99 31 8 281 2 TS2 Sex determination protein tasselseed-2 Zea mays
Q4UK62 4.84e-23 97 30 4 233 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P15047 5.94e-23 97 29 6 262 1 entA 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Escherichia coli (strain K12)
Q9M1K9 1.19e-22 97 33 6 262 1 TA1 Short-chain dehydrogenase reductase ATA1 Arabidopsis thaliana
Q9EQ06 1.25e-22 97 28 2 189 1 Hsd17b11 Estradiol 17-beta-dehydrogenase 11 Mus musculus
Q13268 1.46e-22 96 29 8 260 1 DHRS2 Dehydrogenase/reductase SDR family member 2, mitochondrial Homo sapiens
Q9XT00 1.5e-22 96 31 4 266 3 HSD17B8 (3R)-3-hydroxyacyl-CoA dehydrogenase Sus scrofa
Q7SHI4 1.87e-22 96 29 8 275 2 srdC Short-chain dehydrogenase srdC Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A0QYC2 2.13e-22 95 33 3 253 1 dthD D-threitol dehydrogenase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P71079 2.59e-22 95 29 4 254 1 fabL Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL Bacillus subtilis (strain 168)
H9BFQ1 2.98e-22 95 30 9 271 2 None Tropinone reductase-like 2 Erythroxylum coca
Q8KES3 2.98e-22 95 29 3 210 1 CT0609 Sepiapterin reductase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q92GE0 2.99e-22 95 31 4 215 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P70684 3.8e-22 95 32 6 221 2 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Cavia porcellus
Q5RCH8 4.49e-22 95 27 9 270 2 PECR Peroxisomal trans-2-enoyl-CoA reductase Pongo abelii
P57432 4.95e-22 94 28 4 256 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
K4N0V2 5.89e-22 94 30 6 261 1 BDH Borneol dehydrogenase, mitochondrial Lavandula x intermedia
P0DX40 7.69e-22 95 29 4 251 1 cla-dh CLA biosynthesis dehydrogenase/reductase Lactiplantibacillus plantarum
F4J2Z7 8.24e-22 95 29 4 262 2 SDR4 Short-chain dehydrogenase reductase 4 Arabidopsis thaliana
Q9LBV3 9.51e-22 94 28 6 258 1 barS1 A-factor type gamma-butyrolactone 1'-reductase (1S-forming) Streptomyces virginiae
A0A3Q8GLE8 1.14e-21 94 28 7 261 1 NEPS3 (+)-cis,cis-nepetalactol synthase NEPS3 Nepeta racemosa
Q9S9W2 1.16e-21 94 31 7 260 1 SDRA Short-chain dehydrogenase/reductase SDRA Arabidopsis thaliana
Q68ER2 1.55e-21 93 28 7 255 2 cbr4 Carbonyl reductase family member 4 Xenopus tropicalis
P52037 1.61e-21 93 31 9 259 1 ygfF Uncharacterized oxidoreductase YgfF Escherichia coli (strain K12)
P14697 1.64e-21 93 27 3 255 1 phaB Acetoacetyl-CoA reductase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O07399 1.67e-21 93 30 5 255 3 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium avium
Q71R50 1.83e-21 93 33 4 193 2 DHRS11 Dehydrogenase/reductase SDR family member 11 Gallus gallus
P39644 2.01e-21 93 28 2 255 1 bacG NADPH-dependent reductase BacG Bacillus subtilis (strain 168)
P23102 2.26e-21 93 31 7 257 3 xylL 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase Pseudomonas putida
P9WES5 2.8e-21 93 30 6 257 3 fogB Short-chain dehydrogenase fogB Aspergillus ruber (strain CBS 135680)
I6Y778 2.8e-21 95 31 6 255 1 fabG4 3-oxoacyl-[acyl-carrier-protein] reductase [NADH] Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P05406 3.17e-21 93 30 8 259 3 fixR Protein FixR Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P54554 4.98e-21 92 32 5 232 3 yqjQ Uncharacterized oxidoreductase YqjQ Bacillus subtilis (strain 168)
H9BFQ0 5.47e-21 92 32 8 261 2 None Tropinone reductase-like 1 Erythroxylum coca
P0AET8 7.37e-21 91 29 4 255 1 hdhA 7alpha-hydroxysteroid dehydrogenase Escherichia coli (strain K12)
P0AET9 7.37e-21 91 29 4 255 3 hdhA 7alpha-hydroxysteroid dehydrogenase Escherichia coli O157:H7
Q7FAE1 8.01e-21 92 32 7 260 2 Os04g0179200 Momilactone A synthase Oryza sativa subsp. japonica
Q1RKB7 9.6e-21 91 32 7 217 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia bellii (strain RML369-C)
P9WGS5 9.81e-21 91 29 6 274 1 Rv2750 Uncharacterized oxidoreductase Rv2750 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGS4 9.81e-21 91 29 6 274 3 MT2820 Uncharacterized oxidoreductase MT2820 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0CU00 1.11e-20 90 32 5 196 3 SPAC977.08 Uncharacterized oxidoreductase SPAC977.08 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P0CU01 1.11e-20 90 32 5 196 3 SPAC1348.09 Uncharacterized oxidoreductase SPBC1348.09 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q7T2D1 1.13e-20 92 29 5 217 2 rdh10b Retinol dehydrogenase 10-B Danio rerio
P16543 1.52e-20 90 33 9 257 3 gra-orf6 Granaticin polyketide synthase putative ketoacyl reductase 2 Streptomyces violaceoruber
P27582 1.9e-20 89 35 4 190 1 None 3-oxoacyl-[acyl-carrier-protein] reductase (Fragments) Brassica napus
Q56632 1.98e-20 90 29 7 260 3 vibA Vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CQ62 2.08e-20 92 29 6 258 1 Decr1 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial Mus musculus
N4WE73 2.62e-20 89 30 5 200 3 OXI1 Dehydrogenase OXI1 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
O32291 2.94e-20 91 31 1 187 3 yxnA Uncharacterized oxidoreductase YxnA Bacillus subtilis (strain 168)
O00058 3.81e-20 89 28 4 257 2 PIG8 Probable NADP-dependent mannitol dehydrogenase Uromyces fabae
P39333 3.89e-20 89 27 7 255 1 bdcA Cyclic-di-GMP-binding biofilm dispersal mediator protein Escherichia coli (strain K12)
Q7TQA3 6.2e-20 90 30 4 195 2 Sdr16c5 Epidermal retinol dehydrogenase 2 Mus musculus
P15428 6.21e-20 89 32 5 207 1 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Homo sapiens
P9WGP9 6.88e-20 89 31 3 218 2 sadH Putative oxidoreductase SadH Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGP8 6.88e-20 89 31 3 218 3 sadH Putative oxidoreductase SadH Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P50200 9.13e-20 89 28 7 257 1 None 7alpha-hydroxysteroid dehydrogenase Paraclostridium sordellii
Q8MJY8 1.17e-19 88 32 5 207 2 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Macaca fascicularis
Q8N3Y7 1.24e-19 89 30 3 193 1 SDR16C5 Epidermal retinol dehydrogenase 2 Homo sapiens
B8H1Z0 1.47e-19 88 32 7 256 1 xylB D-xylose 1-dehydrogenase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A9Z0 1.47e-19 88 32 7 256 1 xylB D-xylose 1-dehydrogenase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P31808 1.83e-19 87 29 7 249 1 yciK Uncharacterized oxidoreductase YciK Escherichia coli (strain K12)
Q64591 1.91e-19 89 29 6 258 1 Decr1 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial Rattus norvegicus
Q0WRJ2 1.94e-19 89 32 5 233 1 TSC10A 3-dehydrosphinganine reductase TSC10A Arabidopsis thaliana
M2ZIX7 2.04e-19 89 30 3 193 3 MYCFIDRAFT_6125 Short chain dehydrogenase MYCFIDRAFT_6125 Pseudocercospora fijiensis (strain CIRAD86)
A5PJJ7 2.08e-19 89 30 5 196 2 SDR16C6 Short-chain dehydrogenase/reductase family 16C member 6 Bos taurus
Q94K41 2.26e-19 87 28 7 259 2 SDR3b Short-chain dehydrogenase reductase 3b Arabidopsis thaliana
H1VN83 2.63e-19 87 29 8 245 1 dpchG Short chain dehydrogenase/reductase dpchG Colletotrichum higginsianum (strain IMI 349063)
A7IQF2 2.91e-19 87 34 5 199 3 xecE2 Inactive 2-(S)-hydroxypropyl-CoM dehydrogenase 2 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q06136 3.02e-19 88 32 4 191 1 KDSR 3-ketodihydrosphingosine reductase Homo sapiens
D2WKD9 3.22e-19 87 30 4 197 1 SDR-1 Farnesol dehydrogenase Aedes aegypti
Q3T0C2 4.11e-19 87 31 7 226 2 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Bos taurus
Q1MLL4 5.34e-19 86 29 8 259 1 gdh Galactitol 2-dehydrogenase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q28IU1 8.31e-19 87 32 5 194 2 hsd17b12 Very-long-chain 3-oxoacyl-CoA reductase Xenopus tropicalis
Q6NRV4 9.02e-19 87 26 6 219 2 rdh10-b Retinol dehydrogenase 10-B Xenopus laevis
Q6DCT3 9.11e-19 87 27 6 219 2 rdh10-a Retinol dehydrogenase 10-A Xenopus laevis
Q9P7B4 9.77e-19 85 32 9 239 1 SPAC521.03 NADP-dependent 3-hydroxy acid dehydrogenase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9STY8 1.08e-18 86 32 7 210 3 HSD2 11-beta-hydroxysteroid dehydrogenase-like 2 Arabidopsis thaliana
Q6UWP2 1.21e-18 85 27 6 241 1 DHRS11 Dehydrogenase/reductase SDR family member 11 Homo sapiens
O02691 1.38e-18 85 30 4 210 1 HSD17B10 3-hydroxyacyl-CoA dehydrogenase type-2 Bos taurus
Q05016 1.55e-18 85 31 5 198 1 YMR226C NADP-dependent 3-hydroxy acid dehydrogenase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
F4JZN6 1.99e-18 86 33 3 181 1 TSC10B 3-dehydrosphinganine reductase TSC10B Arabidopsis thaliana
Q9STY7 2.26e-18 85 32 6 193 3 HSD3 11-beta-hydroxysteroid dehydrogenase-like 3 Arabidopsis thaliana
G0RNA2 2.6e-18 85 27 12 298 1 lxr4 L-xylo-3-hexulose reductase Hypocrea jecorina (strain QM6a)
A0A8D5M6H6 3.21e-18 84 30 10 265 1 esdpF Short-chain dehydrogenase/reductase esdpF Penicillium shearii
A0A8F5SIS3 4.05e-18 84 29 10 269 1 BDH1 (+)-borneol dehydrogenase 1 Salvia officinalis
Q2KIJ5 4.2e-18 85 29 6 228 1 KDSR 3-ketodihydrosphingosine reductase Bos taurus
Q5XGF7 4.29e-18 85 26 6 219 2 rdh10 Retinol dehydrogenase 10 Xenopus tropicalis
Q8VCC1 4.66e-18 84 31 5 207 1 Hpgd 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Mus musculus
P57793 6.15e-18 84 27 5 266 1 SAMN02910417_01454 Phloroglucinol reductase Eubacterium oxidoreducens
O53547 6.82e-18 84 31 9 267 1 chsB1 Hydroxyacyl-CoA dehydrogenase ChsB1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q3ZBV9 7.46e-18 83 27 6 241 2 DHRS11 Dehydrogenase/reductase SDR family member 11 Bos taurus
A0A8J9S3B0 8.58e-18 84 25 4 277 3 phomF Short-chain dehydrogenase/reductase PhomF Diaporthe leptostromiformis
O34896 9.36e-18 83 28 8 276 2 uxuB Uncharacterized oxidoreductase UxuB Bacillus subtilis (strain 168)
P00335 9.57e-18 83 31 4 206 1 rbtD Ribitol 2-dehydrogenase Klebsiella aerogenes
G4N290 1.12e-17 83 30 8 270 2 RED2 Short-chain dehydrogenase RED2 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
E3VWK2 1.14e-17 83 30 1 194 3 penF 1-deoxy-11-beta-hydroxypentalenate dehydrogenase Streptomyces exfoliatus
Q46381 1.2e-17 83 30 10 269 1 bphB Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Comamonas testosteroni
Q22230 1.45e-17 83 27 4 257 3 decr-1.3 Probable 2,4-dienoyl-CoA reductase 3 [(3E)-enoyl-CoA-producing] Caenorhabditis elegans
Q9SY73 1.52e-17 82 29 5 206 1 At1g10310 NADPH-dependent pterin aldehyde reductase Arabidopsis thaliana
Q70FD1 1.54e-17 83 26 8 269 1 ALX1 NADH-dependent L-xylulose reductase Ambrosiozyma monospora
Q3U0B3 2.37e-17 82 28 7 241 1 Dhrs11 Dehydrogenase/reductase SDR family member 11 Mus musculus
Q9LUF2 2.57e-17 82 29 8 248 2 HSD7 11-beta-hydroxysteroid dehydrogenase-like 4B Arabidopsis thaliana
P0DKC7 2.57e-17 82 29 8 248 2 HSD4 11-beta-hydroxysteroid dehydrogenase-like 4A Arabidopsis thaliana
P37079 3e-17 82 29 8 270 3 sorD Sorbitol-6-phosphate 2-dehydrogenase Klebsiella pneumoniae
A5JYX5 3.83e-17 82 27 3 195 1 dhs-3 Protein dhs-3 Caenorhabditis elegans
P87218 3.99e-17 82 27 8 264 3 SOU2 Sorbose reductase homolog SOU2 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6P3L6 4.19e-17 82 31 6 195 2 hsd17b12a Very-long-chain 3-oxoacyl-CoA reductase-A Danio rerio
Q6GV12 4.41e-17 82 30 4 191 1 Kdsr 3-ketodihydrosphingosine reductase Mus musculus
Q9LUE4 4.42e-17 82 33 6 193 2 HSD6 11-beta-hydroxysteroid dehydrogenase-like 6 Arabidopsis thaliana
Q01198 4.74e-17 82 29 1 188 3 ligD C alpha-dehydrogenase Sphingobium sp. (strain NBRC 103272 / SYK-6)
P50166 5.16e-17 81 26 9 273 1 ARD D-arabinitol 2-dehydrogenase [ribulose-forming] Candida tropicalis
P22441 6.18e-17 81 31 6 260 1 None N-acylmannosamine 1-dehydrogenase Flavobacterium sp. (strain 141-8)
A0A142I726 6.18e-17 81 25 4 271 3 PhomF' Short-chain dehydrogenase/reductase PhomF' Diaporthe leptostromiformis
Q99714 6.29e-17 81 30 4 210 1 HSD17B10 3-hydroxyacyl-CoA dehydrogenase type-2 Homo sapiens
Q9NUI1 7.31e-17 81 28 5 255 1 DECR2 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] Homo sapiens
P9WGQ5 8e-17 80 29 6 258 1 Rv0927c Uncharacterized oxidoreductase Rv0927c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGQ4 8e-17 80 29 6 258 3 MT0954 Uncharacterized oxidoreductase MT0954 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q05A13 9.43e-17 81 26 3 195 2 Sdr16c6 Short-chain dehydrogenase/reductase family 16C member 6 Mus musculus
P9WEW9 9.59e-17 80 28 5 194 1 dpfgG Short chain dehydrogenase/reductase dpfgG Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
F1QWW8 1.33e-16 81 30 4 191 1 kdsr 3-dehydrosphinganine reductase Danio rerio
Q5RBV3 1.35e-16 80 27 5 255 2 DECR2 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] Pongo abelii
Q9MYP6 1.35e-16 80 30 7 253 2 HSD17B14 17-beta-hydroxysteroid dehydrogenase 14 Bos taurus
Q7Q732 1.43e-16 80 28 7 249 3 AGAP005532 Dehydrogenase/reductase SDR family protein 7-like Anopheles gambiae
A0A162J3X8 1.61e-16 80 26 6 252 1 citE Short chain dehydrogenase citE Monascus ruber
A0A144Y7G4 1.61e-16 80 26 6 252 1 mpl6 Short chain dehydrogenase mpl6 Monascus purpureus
O31767 1.68e-16 79 28 7 253 3 ymfI Uncharacterized oxidoreductase YmfI Bacillus subtilis (strain 168)
Q99MZ7 2e-16 80 24 6 243 1 Pecr Peroxisomal trans-2-enoyl-CoA reductase Mus musculus
Q8NK50 2.69e-16 79 27 7 265 1 lxr1 NADP-dependent mannitol dehydrogenase Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30)
Q9Z2M4 2.96e-16 79 29 7 261 1 Decr2 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] Rattus norvegicus
Q56318 3.41e-16 79 27 4 265 3 TM_0019 Uncharacterized oxidoreductase TM_0019 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9RPT1 3.59e-16 79 27 5 261 1 rhlG Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8VCH7 4.33e-16 80 26 5 219 1 Rdh10 Retinol dehydrogenase 10 Mus musculus
Q8IZV5 4.59e-16 79 26 5 219 1 RDH10 Retinol dehydrogenase 10 Homo sapiens
Q8HZT6 4.59e-16 79 26 5 219 1 RDH10 Retinol dehydrogenase 10 Bos taurus
G3YG17 4.68e-16 79 28 9 300 1 lxrA L-xylulose reductase Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
O57314 4.83e-16 79 31 6 223 2 HSD17B12 Very-long-chain 3-oxoacyl-CoA reductase Anas platyrhynchos
Q80ZF7 4.97e-16 79 26 5 219 1 Rdh10 Retinol dehydrogenase 10 Rattus norvegicus
Q9KJF2 5.98e-16 78 28 6 252 1 bbsC (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsC Thauera aromatica
O70351 6.25e-16 78 27 8 276 1 Hsd17b10 3-hydroxyacyl-CoA dehydrogenase type-2 Rattus norvegicus
Q4WZ66 7.65e-16 78 28 8 262 1 easD Chanoclavine-I dehydrogenase easD Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
D3J0Z1 7.65e-16 78 28 8 262 1 fgaDH Chanoclavine-I dehydrogenase Aspergillus fumigatus
Q5XG41 8.47e-16 79 31 4 193 2 hsd17b12-a Very-long-chain 3-oxoacyl-CoA reductase-A Xenopus laevis
P50206 1.01e-15 78 29 9 268 3 bphB Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Pseudomonas sp. (strain KKS102)
Q8AVY8 1.2e-15 78 30 5 194 2 hsd17b12-b Very-long-chain 3-oxoacyl-CoA reductase-B Xenopus laevis
P37058 1.26e-15 78 28 7 193 1 HSD17B3 17-beta-hydroxysteroid dehydrogenase type 3 Homo sapiens
Q6P7R8 1.4e-15 78 32 7 195 2 Hsd17b12 Very-long-chain 3-oxoacyl-CoA reductase Rattus norvegicus
Q82IY9 1.45e-15 77 29 1 194 1 ptlF 1-deoxy-11-beta-hydroxypentalenate dehydrogenase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
O32229 1.74e-15 77 25 8 279 3 yvaG Uncharacterized oxidoreductase YvaG Bacillus subtilis (strain 168)
O70503 1.78e-15 77 32 7 195 1 Hsd17b12 Very-long-chain 3-oxoacyl-CoA reductase Mus musculus
P43066 1.86e-15 77 25 9 273 3 ARD1 D-arabinitol 2-dehydrogenase [ribulose-forming] Candida albicans (strain WO-1)
G9N4B1 1.9e-15 77 29 8 271 1 virB Short-chain dehydrogenase virB Hypocrea virens (strain Gv29-8 / FGSC 10586)
P9WEQ5 2e-15 77 31 9 259 3 olcF Short-chain dehydrogenase/reductase olcF Penicillium canescens
Q5E9H7 2.1e-15 77 31 6 202 2 HSD17B12 Very-long-chain 3-oxoacyl-CoA reductase Bos taurus
P50167 2.11e-15 77 25 7 270 2 ARDH D-arabinitol 2-dehydrogenase [ribulose-forming] Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
A0A0E3D8L9 2.18e-15 77 26 10 261 3 PC-15 Short-chain dehydrogenase PC-15 Penicillium crustosum
P55435 2.25e-15 76 26 6 263 3 NGR_a03830 Uncharacterized short-chain type dehydrogenase/reductase y4eL Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A1L1W4 2.29e-15 77 24 3 215 2 rdh10a Retinol dehydrogenase 10-A Danio rerio
Q99L04 3.64e-15 77 28 8 250 1 Dhrs1 Dehydrogenase/reductase SDR family member 1 Mus musculus
Q9BPX1 4.03e-15 76 29 6 197 1 HSD17B14 17-beta-hydroxysteroid dehydrogenase 14 Homo sapiens
G0RH19 4.06e-15 76 26 8 277 1 lxr3 L-xylulose reductase Hypocrea jecorina (strain QM6a)
O34308 4.15e-15 75 27 8 255 3 ytkK Putative oxidoreductase YtkK Bacillus subtilis (strain 168)
Q96LJ7 4.43e-15 76 29 9 251 1 DHRS1 Dehydrogenase/reductase SDR family member 1 Homo sapiens
Q53GQ0 4.94e-15 76 30 6 195 1 HSD17B12 Very-long-chain 3-oxoacyl-CoA reductase Homo sapiens
P47230 5.13e-15 76 28 8 268 3 bphB Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Rhodococcus globerulus
Q8A945 5.36e-15 75 32 5 204 1 kdsr 3-ketodihydrosphingosine reductase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P51659 5.9e-15 77 32 3 191 1 HSD17B4 Peroxisomal multifunctional enzyme type 2 Homo sapiens
C5FTN0 5.9e-15 75 28 8 264 3 easD Chanoclavine-I dehydrogenase easD Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
P44481 6.9e-15 75 26 7 273 1 HI_0048 Uncharacterized oxidoreductase HI_0048 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A1B2CTA9 7.82e-15 75 27 10 268 1 penD Short chain dehydrogenase penD Penicillium thymicola
Q5RA68 7.86e-15 77 26 6 263 2 HSDL2 Hydroxysteroid dehydrogenase-like protein 2 Pongo abelii
P40747 8.73e-15 77 30 9 263 3 yuxG Uncharacterized oxidoreductase YuxG Bacillus subtilis (strain 168)
E3VWI6 9.24e-15 75 30 2 198 3 pntF 1-deoxy-11-beta-hydroxypentalenate dehydrogenase Streptomyces arenae
Q4R5G7 9.73e-15 75 30 6 195 2 HSD17B12 Very-long-chain 3-oxoacyl-CoA reductase Macaca fascicularis
A6SSW9 1.5e-14 74 28 3 187 2 BOA17 Oxidoreductase BOA17 Botryotinia fuckeliana (strain B05.10)
Q6YN16 1.68e-14 75 26 6 263 1 HSDL2 Hydroxysteroid dehydrogenase-like protein 2 Homo sapiens
A0A165U5V5 1.68e-14 74 28 8 264 1 ADH1 Short chain aldehyde dehydrogenase 1 Euphorbia lathyris
O54939 1.92e-14 74 27 7 198 2 Hsd17b3 17-beta-hydroxysteroid dehydrogenase type 3 Rattus norvegicus
Q8LEU3 2.01e-14 75 29 5 193 1 NOL Chlorophyll(ide) b reductase NOL, chloroplastic Arabidopsis thaliana
A0A140JWS5 2.13e-14 74 25 10 261 3 ptmH Short-chain dehydrogenase ptmH Penicillium simplicissimum
O08756 2.16e-14 74 29 4 210 1 Hsd17b10 3-hydroxyacyl-CoA dehydrogenase type-2 Mus musculus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10305
Feature type CDS
Gene -
Product acetoin reductase
Location 2259253 - 2260032 (strand: -1)
Length 780 (nucleotides) / 259 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_877
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00106 short chain dehydrogenase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1028 Lipid transport and metabolism (I) I NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03366 meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304] Butanoate metabolism
Biosynthesis of secondary metabolites		 -

Protein Sequence

MALNGKVILVTGAAQGIGRGIALRLAKEGADIALVDLKADKLSDVAKEIEALGRKVTTFAADISNRDEVFAAVEHAEKTLGGFDVMINNAGIAQVKPLADVTPEDMDRIFKINVNGVMWGIQAASEKFKALGHKGKIINASSIAGHDGFAMLGVYSATKFAVRALTQAAAKEYASAGITVNAYCPGIVGTDMWVEIDERFAEITGAPKGETYKKYVDGIALGRAQTPDDVAALVSFLASDDSDYITGQAILTDGGIVYR

Flanking regions ( +/- flanking 50bp)

GTTCTTTTTTGGAAGAGCTTTTTCATCTGTAAATATTCAGGAGAAAGACAATGGCTTTGAATGGTAAAGTAATTTTAGTTACAGGTGCTGCTCAGGGAATTGGTCGTGGTATCGCATTACGTCTTGCTAAAGAGGGTGCCGATATTGCTCTGGTTGACTTAAAAGCAGATAAATTATCCGATGTAGCAAAAGAAATTGAAGCGTTAGGGCGTAAAGTAACGACCTTTGCTGCAGATATTAGCAACCGTGATGAAGTCTTTGCGGCAGTTGAACATGCTGAAAAAACCTTAGGCGGTTTTGATGTTATGATCAATAACGCAGGTATTGCACAGGTGAAACCTCTTGCAGATGTGACTCCGGAAGATATGGATCGGATCTTCAAAATTAACGTTAATGGTGTGATGTGGGGTATTCAGGCCGCTTCTGAGAAATTTAAAGCATTAGGCCATAAAGGGAAGATTATTAATGCATCTTCTATTGCTGGGCACGATGGTTTTGCCATGTTAGGGGTTTATTCTGCCACTAAATTTGCAGTACGTGCATTAACACAAGCGGCAGCTAAAGAGTATGCGAGCGCAGGCATCACTGTTAATGCTTATTGCCCGGGCATTGTCGGCACCGATATGTGGGTTGAGATTGACGAGCGTTTCGCTGAAATTACTGGAGCACCAAAAGGTGAGACCTATAAAAAATATGTGGACGGTATTGCTCTAGGACGTGCTCAAACTCCTGATGACGTAGCTGCGTTAGTTTCCTTCTTGGCAAGTGATGATTCCGACTATATTACGGGCCAAGCTATCTTAACCGATGGCGGTATTGTCTATCGTTAATTATTGATTACTTAATCATAATTGTTATTTGTGCCCCGAGTTATTCACTA