Homologs in group_877

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04490 FBDBKF_04490 95.0 Morganella morganii S1 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
EHELCC_05780 EHELCC_05780 95.0 Morganella morganii S2 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
NLDBIP_06100 NLDBIP_06100 95.0 Morganella morganii S4 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
LHKJJB_02980 LHKJJB_02980 95.0 Morganella morganii S3 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
HKOGLL_06455 HKOGLL_06455 95.0 Morganella morganii S5 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
PMI_RS10305 PMI_RS10305 85.7 Proteus mirabilis HI4320 - acetoin reductase

Distribution of the homologs in the orthogroup group_877

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_877

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q48436 6.15e-93 277 54 0 254 1 budC Diacetyl reductase [(S)-acetoin forming] Klebsiella pneumoniae
Q8CQD2 1.62e-85 258 51 1 255 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HKG6 1.75e-85 258 50 1 255 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9ZNN8 5.51e-85 257 54 1 256 1 budC L-2,3-butanediol dehydrogenase Corynebacterium glutamicum
P66776 6.89e-73 226 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain MW2)
Q6GCZ8 6.89e-73 226 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain MSSA476)
Q6GKH9 6.89e-73 226 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain MRSA252)
P99120 6.89e-73 226 47 0 254 1 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain N315)
P66775 6.89e-73 226 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJP2 6.89e-73 226 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain COL)
Q04520 6e-68 213 54 0 194 3 budC Diacetyl reductase [(S)-acetoin forming] Raoultella terrigena
A0A2H3D8Y2 2.64e-67 212 46 2 256 1 ARMGADRAFT_1018421 Short-chain dehydrogenase/reductase ARMGADRAFT_1018421 Armillaria gallica
A9CES4 2.25e-49 166 39 1 255 1 Atu3164 Galactitol 2-dehydrogenase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q59787 2.41e-48 163 36 1 255 1 polS Sorbitol dehydrogenase Cereibacter sphaeroides
Q9X248 9.63e-45 154 36 2 257 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A0A1V0QSC6 1.6e-44 153 39 4 263 1 eriH Short-chain dehydrogenase/reductase eriH Hericium erinaceus
C8WGQ3 1.57e-42 148 35 5 259 1 Elen_1325 3beta-hydroxysteroid dehydrogenase 2 Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)
P51831 6.01e-42 146 36 4 257 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Bacillus subtilis (strain 168)
P9WGT1 1.22e-40 143 39 5 257 1 fabG3 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P69166 1.22e-40 143 39 5 257 3 fabG3 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P94681 1.3e-40 143 35 4 256 1 tsaC1 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 Comamonas testosteroni
Q49117 1.45e-40 143 38 3 255 3 MexAM1_META1p0182 Uncharacterized oxidoreductase MexAM1_META1p0182 Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
P0A0I0 4.39e-40 142 37 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain MW2)
Q6G9Y2 4.39e-40 142 37 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain MSSA476)
Q6GHK4 4.39e-40 142 37 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain MRSA252)
P99093 4.39e-40 142 37 5 258 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain N315)
P0A0H9 4.39e-40 142 37 5 258 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGK2 4.39e-40 142 37 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain COL)
P9WGT0 6.89e-40 141 38 5 257 3 fabG3 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P37769 7.51e-40 141 33 3 262 1 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Escherichia coli (strain K12)
Q5FPE5 1.51e-39 141 37 6 261 1 GOX2015 Glucose 1-dehydrogenase Gluconobacter oxydans (strain 621H)
E9ET40 3.68e-39 140 35 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q8XBJ4 6.12e-39 139 35 6 256 3 ucpA Oxidoreductase UcpA Escherichia coli O157:H7
Q93X67 8.82e-39 140 38 5 252 2 bkr2 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic Brassica napus
Q949M3 8.86e-39 140 38 5 252 2 bkr3 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic Brassica napus
Q93X62 9.71e-39 140 38 5 252 1 gbkr1 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic Brassica napus
P37440 1.38e-38 138 35 6 256 1 ucpA Oxidoreductase UcpA Escherichia coli (strain K12)
P0A2D1 2.56e-38 137 36 6 256 3 ucpA Oxidoreductase UcpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D2 2.56e-38 137 36 6 256 3 ucpA Oxidoreductase UcpA Salmonella typhi
A0A0B4GT47 3.77e-38 137 35 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium anisopliae (strain ARSEF 549)
A0A0B4FP77 3.86e-38 137 35 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium brunneum (strain ARSEF 3297)
Q8CPI3 1.2e-37 135 36 3 252 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPW0 1.2e-37 135 36 3 252 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P40398 1.56e-37 136 36 5 260 3 yhxD Uncharacterized oxidoreductase YhxD Bacillus subtilis (strain 168)
A0A0B4HVU2 1.7e-37 135 35 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium majus (strain ARSEF 297)
P80873 2.11e-37 136 36 5 255 1 ydaD General stress protein 39 Bacillus subtilis (strain 168)
Q00791 3.98e-37 134 34 5 260 2 stcU Versicolorin reductase stcU Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P28643 4.89e-37 135 36 5 258 2 CLKR27 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic Cuphea lanceolata
A0A0B4GU97 6.16e-37 134 34 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium guizhouense (strain ARSEF 977)
Q937L4 2.84e-36 132 34 3 250 1 cpnA Cyclopentanol dehydrogenase Comamonas testosteroni
Q8GAV9 2.84e-36 132 34 3 250 1 cpnA Cyclopentanol dehydrogenase Comamonas sp. (strain NCIMB 9872)
P66782 3.94e-36 131 34 4 255 3 fabG2 Uncharacterized oxidoreductase Mb1385 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGR9 3.94e-36 131 34 4 255 1 fabG2 Uncharacterized oxidoreductase Rv1350 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGR8 3.94e-36 131 34 4 255 3 fabG2 Uncharacterized oxidoreductase MT1393 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q05528 9.88e-36 130 33 3 261 1 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Dickeya dadantii (strain 3937)
Q6TMA3 1.09e-35 131 35 9 280 1 chnA Cyclohexanol dehydrogenase Rhodococcus sp. (strain TK6)
P80869 1.44e-35 130 32 3 256 1 ycdF Glucose 1-dehydrogenase 2 Bacillus subtilis (strain 168)
A7AZH2 2.05e-35 130 34 6 267 1 RUMGNA_00694 3beta-hydroxysteroid dehydrogenase Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)
Q9KJF1 2.32e-35 129 32 5 257 1 bbsD (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD Thauera aromatica
P33207 2.36e-35 131 36 5 252 1 At1g24360 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic Arabidopsis thaliana
E9EHG1 3.03e-35 130 33 5 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium acridum (strain CQMa 102)
Q988B7 4.13e-35 129 35 5 257 1 pldh-t Pyridoxal 4-dehydrogenase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
H9XP47 4.26e-35 129 34 5 255 1 budC Meso-2,3-butanediol dehydrogenase Serratia marcescens
P39483 4.85e-35 129 31 4 256 3 gdhII Glucose 1-dehydrogenase 2 Priestia megaterium
A0A411PQN6 7.03e-35 129 33 5 257 3 AgnL6 Short chain dehydrogenase AgnL6 Paecilomyces divaricatus
O67610 7.19e-35 128 33 3 257 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Aquifex aeolicus (strain VF5)
P50161 7.85e-35 128 33 6 261 1 aflM Versicolorin reductase 1 Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
Q9PKF7 8.8e-35 128 32 3 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Chlamydia muridarum (strain MoPn / Nigg)
Q949M2 2.39e-34 127 36 6 252 2 bkr4 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) Brassica napus
A7B3K3 2.6e-34 127 33 3 256 1 baiA 3alpha-hydroxysteroid dehydrogenase Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)
P50842 2.86e-34 127 35 7 265 2 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Bacillus subtilis (strain 168)
Q9Z8P2 4.16e-34 126 32 3 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Chlamydia pneumoniae
Q9WYG0 4.2e-34 126 32 4 256 3 TM_0325 Uncharacterized oxidoreductase TM_0325 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8JZV9 4.48e-34 126 35 8 254 1 Bdh2 Dehydrogenase/reductase SDR family member 6 Mus musculus
W3XC32 5.61e-34 127 32 5 257 2 Pfmaj Trihydroxynaphthalene reductase PfmaI Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q92506 5.89e-34 126 33 3 256 1 HSD17B8 (3R)-3-hydroxyacyl-CoA dehydrogenase Homo sapiens
Q21929 7.54e-34 125 33 3 257 1 dhs-21 L-xylulose reductase Caenorhabditis elegans
P39484 1.06e-33 125 31 4 256 3 gdhIII Glucose 1-dehydrogenase 3 Priestia megaterium
P39485 1.29e-33 125 31 4 256 1 gdhIV Glucose 1-dehydrogenase 4 Priestia megaterium
P42317 1.5e-33 125 33 2 248 3 yxjF Uncharacterized oxidoreductase YxjF Bacillus subtilis (strain 168)
P10528 1.58e-33 125 31 4 256 3 gdhA Glucose 1-dehydrogenase A Priestia megaterium
P9WGQ9 2.3e-33 124 34 5 257 1 Rv0769 Uncharacterized oxidoreductase Rv0769 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGQ8 2.3e-33 124 34 5 257 3 MT0793 Uncharacterized oxidoreductase MT0793 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9F7E0 2.59e-33 124 33 4 253 1 chnA Cyclohexanol dehydrogenase Acinetobacter sp. (strain SE19)
Q45219 3.24e-33 125 33 4 257 3 blr2146 Probable short-chain type dehydrogenase/reductase blr2146 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q93X68 3.33e-33 125 35 5 251 2 bkr1 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) Brassica napus
P39640 5.19e-33 123 33 4 256 1 bacC Dihydroanticapsin 7-dehydrogenase Bacillus subtilis (strain 168)
Q5TJF5 5.56e-33 124 33 3 256 3 HSD17B8 (3R)-3-hydroxyacyl-CoA dehydrogenase Canis lupus familiaris
P12310 5.83e-33 124 30 4 255 2 gdh Glucose 1-dehydrogenase Bacillus subtilis (strain 168)
P17611 6.77e-33 123 34 3 258 3 nodG Nodulation protein G Azospirillum brasilense
Q5KTS5 6.86e-33 124 34 6 264 2 CAISE5 Glucose and ribitol dehydrogenase Daucus carota
P87025 7.02e-33 124 31 5 257 3 THR1 Trihydroxynaphthalene reductase Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)
O54438 7.08e-33 123 32 2 256 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A384JQF5 7.79e-33 123 35 5 258 2 aba4 Short-chain dehydrogenase/reductase aba4 Botryotinia fuckeliana (strain B05.10)
A0A1L9WLH9 8.78e-33 123 31 7 264 1 AacuN Short chain dehydrogenase/reductase AacuN Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
Q8KWT4 8.91e-33 123 32 4 256 1 bacC Dihydroanticapsin 7-dehydrogenase Bacillus subtilis
P39482 1.08e-32 123 29 3 255 2 gdhI Glucose 1-dehydrogenase 1 Priestia megaterium
O07575 1.1e-32 124 33 6 255 3 yhdF Uncharacterized oxidoreductase YhdF Bacillus subtilis (strain 168)
P38004 1.32e-32 122 31 3 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P40288 1.39e-32 122 29 3 255 1 None Glucose 1-dehydrogenase Priestia megaterium
F9XMW6 1.7e-32 122 33 6 260 3 MYCGRDRAFT_87994 Probable tetrahydroxynaphthalene reductase MYCGRDRAFT_87994 Zymoseptoria tritici (strain CBS 115943 / IPO323)
P50199 1.79e-32 122 31 3 258 1 gno Gluconate 5-dehydrogenase Gluconobacter oxydans (strain 621H)
M1W270 2.05e-32 122 31 5 261 2 CPUR_05429 Short chain dehydrogenase CPUR_05429 Claviceps purpurea (strain 20.1)
Q3KPT7 2.26e-32 122 35 8 255 2 bdh2 Dehydrogenase/reductase SDR family member 6 Xenopus laevis
D4A1J4 2.65e-32 121 35 7 254 1 Bdh2 Dehydrogenase/reductase SDR family member 6 Rattus norvegicus
P50164 3.07e-32 122 31 4 257 2 TR2 Tropinone reductase 2 Hyoscyamus niger
Q10216 3.19e-32 122 33 7 258 3 SPAC4H3.08 Uncharacterized oxidoreductase C4H3.08 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q14RS1 3.29e-32 121 35 5 258 2 aba4 Short-chain dehydrogenase/reductase aba4 Botryotinia fuckeliana
P55541 3.34e-32 122 31 4 258 3 NGR_a02730 Uncharacterized short-chain type dehydrogenase/reductase y4lA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A0A1L5BUG8 3.59e-32 121 34 4 255 3 linB 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)
A0A5B8YU81 4e-32 121 33 7 263 2 GME11373 Short-chain dehydrogenase/reductase GME11373 Pestalotiopsis microspora
Q5P5I4 4.28e-32 121 34 4 256 1 ped (S)-1-Phenylethanol dehydrogenase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q08632 4.3e-32 121 33 7 266 2 None Short-chain type dehydrogenase/reductase Picea abies
Q9URX0 5.24e-32 121 32 7 259 3 SPAC922.06 Uncharacterized oxidoreductase C922.06 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q561X9 6.2e-32 120 35 9 256 2 bdh2 Dehydrogenase/reductase SDR family member 6 Danio rerio
Q3T046 9.09e-32 120 34 7 255 2 BDH2 Dehydrogenase/reductase SDR family member 6 Bos taurus
Q9RA05 9.58e-32 120 33 6 276 1 limC (-)-trans-carveol dehydrogenase Rhodococcus erythropolis
I6YCF0 9.77e-32 120 33 3 250 1 ipdF (5R,7aS)-5-hydroxy-7a-methyl-1-oxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q75KH3 1.15e-31 121 32 6 270 2 Os05g0140800 Glucose and ribitol dehydrogenase homolog Oryza sativa subsp. japonica
C1C4R8 1.43e-31 119 34 8 255 2 bdh2 Dehydrogenase/reductase SDR family member 6 Aquarana catesbeiana
P0DXE0 1.53e-31 120 33 4 256 1 chcB1 Trans-4-hydroxycyclohexanecarboxylate dehydrogenase Corynebacterium cyclohexanicum
D4YYG1 1.53e-31 119 34 4 255 1 linC 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)
A7DY56 1.67e-31 120 31 4 257 1 TR Tropinone reductase Cochlearia officinalis
P50163 2.15e-31 119 31 4 257 1 TR2 Tropinone reductase 2 Datura stramonium
Q12634 3.04e-31 119 32 7 267 1 MGG_02252 Tetrahydroxynaphthalene reductase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P41177 3.58e-31 119 33 1 254 3 None Monensin polyketide synthase putative ketoacyl reductase Streptomyces virginiae
Q9KQH7 7.71e-31 117 31 3 256 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q15SS0 8.59e-31 117 36 8 265 1 Patl_2552 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
M2WJF1 9.1e-31 118 30 6 262 2 ver1 Versicolorin reductase 1 Dothistroma septosporum (strain NZE10 / CBS 128990)
Q8TFD5 9.1e-31 118 30 6 262 2 ver1 Versicolorin reductase 1 Dothistroma septosporum
D4Z260 9.37e-31 117 34 2 253 1 linX 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)
A0A1L5BU05 9.37e-31 117 34 2 253 3 linX 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)
Q9LHT0 1.05e-30 118 33 4 256 2 At5g06060 Tropinone reductase homolog At5g06060 Arabidopsis thaliana
E9QUT3 1.05e-30 118 32 4 253 3 arp2 Hydroxynaphthalene reductase arp2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P73574 1.2e-30 117 33 5 259 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0AG84 1.43e-30 118 33 4 256 1 yghA Uncharacterized oxidoreductase YghA Escherichia coli (strain K12)
P0AG85 1.43e-30 118 33 4 256 3 yghA Uncharacterized oxidoreductase YghA Escherichia coli O157:H7
O31680 1.44e-30 117 32 4 252 3 ykvO Uncharacterized oxidoreductase YkvO Bacillus subtilis (strain 168)
P40397 1.49e-30 118 32 8 263 3 yhxC Uncharacterized oxidoreductase YhxC Bacillus subtilis (strain 168)
P50941 1.73e-30 116 31 4 257 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia prowazekii (strain Madrid E)
Q9ZW04 3.18e-30 117 32 5 256 3 At2g29170 Tropinone reductase homolog At2g29170 Arabidopsis thaliana
Q8WNV7 3.79e-30 117 30 5 259 1 DHRS4 Dehydrogenase/reductase SDR family member 4 Sus scrofa
P16544 4.28e-30 116 32 2 252 1 actIII Putative ketoacyl reductase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9X6U2 4.45e-30 116 33 2 256 3 hbdH1 D-beta-hydroxybutyrate dehydrogenase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P33368 5.74e-30 115 31 2 253 1 yohF Uncharacterized oxidoreductase YohF Escherichia coli (strain K12)
P0CU75 6.79e-30 115 30 8 263 1 claC Short chain dehydrogenase claC Passalora fulva
Q9LBG2 9.31e-30 115 30 4 256 1 lvr Levodione reductase Leifsonia aquatica
P37694 1.04e-29 115 32 5 253 3 hetN Ketoacyl reductase HetN Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P55336 1.06e-29 114 31 4 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Vibrio harveyi
P0C622 1.09e-29 115 29 3 256 3 cmtB 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase Pseudomonas putida
A5W4G5 1.09e-29 115 29 3 256 3 cmtB 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A7IQH5 1.12e-29 115 32 4 240 1 xecE3 2-(S)-hydroxypropyl-CoM dehydrogenase 3 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P06234 1.33e-29 114 31 3 254 3 nodG Nodulation protein G Rhizobium meliloti (strain 1021)
Q5BH34 1.61e-29 115 30 5 260 1 mdpC Short chain dehydrogenase mdpC Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9SQR4 1.72e-29 115 31 6 270 3 At3g03980 NADPH-dependent aldehyde reductase-like protein, chloroplastic Arabidopsis thaliana
Q9ZW03 1.73e-29 114 32 7 258 1 At2g29150 Tropinone reductase homolog At2g29150 Arabidopsis thaliana
Q6WVP7 1.81e-29 114 31 5 259 1 adh NADP-dependent (R)-specific alcohol dehydrogenase Lentilactobacillus kefiri
P07999 2.02e-29 114 29 6 259 1 gdhB Glucose 1-dehydrogenase B Priestia megaterium
P23238 2.19e-29 114 33 4 254 3 phaB Acetoacetyl-CoA reductase Shinella zoogloeoides
P43713 2.55e-29 114 31 5 259 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q99LB2 2.91e-29 114 30 5 259 1 Dhrs4 Dehydrogenase/reductase SDR family member 4 Mus musculus
Q6MGB5 3e-29 114 35 4 259 1 Hsd17b8 (3R)-3-hydroxyacyl-CoA dehydrogenase Rattus norvegicus
P46331 3.41e-29 114 32 5 257 3 yxbG Uncharacterized oxidoreductase YxbG Bacillus subtilis (strain 168)
Q8P3K4 4.06e-29 114 33 6 254 1 XCC4067 2-keto-3-deoxy-L-fuconate dehydrogenase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P72332 4.48e-29 113 31 3 254 3 nodG Nodulation protein G Rhizobium sp. (strain N33)
Q9ZW18 4.61e-29 114 32 4 256 1 SAG13 Senescence-associated protein 13 Arabidopsis thaliana
A0A4P8DJW8 6.65e-29 113 30 7 263 3 dmxR18 Short chain dehydrogenase/reductase dmxR18 Cryptosporiopsis sp. (strain 8999)
C8WJW0 6.77e-29 113 33 4 255 1 Elen_0198 3beta-hydroxysteroid dehydrogenase 1 Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)
P14802 8.24e-29 112 39 1 196 3 yoxD Uncharacterized oxidoreductase YoxD Bacillus subtilis (strain 168)
P50205 9.02e-29 112 32 3 250 3 phaB Acetoacetyl-CoA reductase Rhizobium meliloti (strain 1021)
P19871 1.25e-28 112 33 5 260 1 None 3-beta-hydroxysteroid dehydrogenase Comamonas testosteroni
O86034 1.58e-28 112 33 6 262 1 bdhA D-beta-hydroxybutyrate dehydrogenase Rhizobium meliloti (strain 1021)
Q9MA93 1.76e-28 112 32 7 264 2 At3g05260 Glucose and ribitol dehydrogenase homolog 2 Arabidopsis thaliana
Q9L9F8 2.09e-28 112 33 3 247 1 novJ Short-chain reductase protein NovJ Streptomyces niveus
Q9SQR2 2.75e-28 112 32 8 271 1 ChlADR2 NADPH-dependent aldehyde reductase 2, chloroplastic Arabidopsis thaliana
Q68VY7 2.94e-28 110 30 4 257 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q6P0H7 2.95e-28 110 32 4 248 2 cbr4 Carbonyl reductase family member 4 Danio rerio
P16542 3.26e-28 111 35 2 231 3 gra-orf5 Granaticin polyketide synthase putative ketoacyl reductase 1 Streptomyces violaceoruber
A0A1A9TAK5 3.63e-28 111 31 5 258 1 NR Noroxomaritidine/norcraugsodine reductase Narcissus pseudonarcissus
A0A1C9II22 3.63e-28 111 31 5 258 1 NR Noroxomaritidine/norcraugsodine reductase Narcissus aff. pseudonarcissus MK-2014
Q8JIS3 3.86e-28 110 31 5 264 1 DER D-erythrulose reductase Gallus gallus
Q9HK58 4.96e-28 110 30 4 259 1 rhaD L-rhamnose 1-dehydrogenase (NADP(+)) Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
P0DKI3 5.5e-28 110 32 4 257 1 At1g07440 Tropinone reductase homolog At1g07440 Arabidopsis thaliana
Q89AG9 6.25e-28 110 26 4 256 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B0ZT44 6.64e-28 110 32 6 260 2 RDT1 Elsinochrome reductase 1 Elsinoe fawcettii
A0A1U8QWA2 7.32e-28 115 37 1 191 1 ATRR Glycine betaine reductase ATRR Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8KWS9 7.4e-28 110 31 7 259 1 bacC Dihydroanticapsin 7-dehydrogenase Bacillus amyloliquefaciens
Q9ZW13 7.6e-28 110 31 4 256 2 At2g29290 Tropinone reductase homolog At2g29290 Arabidopsis thaliana
A0A2I1C3T5 8.36e-28 110 29 6 262 1 nsrJ Short chain dehydrogenase/reductase nsrJ Aspergillus novofumigatus (strain IBT 16806)
P0AEK3 9.12e-28 109 31 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Shigella flexneri
P0AEK2 9.12e-28 109 31 5 258 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Escherichia coli (strain K12)
Q92EU6 1.04e-27 109 30 6 259 1 golD NAD-dependent glycerol dehydrogenase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
H9BFQ2 1.13e-27 109 31 6 257 2 None Tropinone reductase-like 3 Erythroxylum coca
Q9FZ42 1.17e-27 110 31 6 264 1 ChlADR1 NADPH-dependent aldehyde reductase 1, chloroplastic Arabidopsis thaliana
P0DXE1 1.37e-27 109 33 5 251 1 chcB2 Cis-4-hydroxycyclohexanecarboxylate dehydrogenase Corynebacterium cyclohexanicum
P50162 1.38e-27 110 32 6 259 1 TR1 Tropinone reductase 1 Datura stramonium
Q4A054 1.53e-27 108 35 3 194 3 SSP0419 Uncharacterized oxidoreductase SSP0419 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0A2C9 1.58e-27 109 31 5 258 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D0 1.58e-27 109 31 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Salmonella typhi
Q8SPU8 1.68e-27 110 30 5 256 2 DHRS4 Dehydrogenase/reductase SDR family member 4 Bos taurus
C0KTJ6 1.75e-27 109 33 6 257 1 None Galactitol 2-dehydrogenase (L-tagatose-forming) Cereibacter sphaeroides
Q8NUV9 2.07e-27 108 33 2 188 3 MW2403 Uncharacterized oxidoreductase MW2403 Staphylococcus aureus (strain MW2)
Q6G6J1 2.07e-27 108 33 2 188 3 SAS2370 Uncharacterized oxidoreductase SAS2370 Staphylococcus aureus (strain MSSA476)
A0R518 2.21e-27 109 31 4 270 1 MSMEG_6031 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8VID1 3.28e-27 109 30 5 260 2 Dhrs4 Dehydrogenase/reductase SDR family member 4 Rattus norvegicus
Q9ZW14 3.3e-27 108 33 5 256 2 At2g29310 Tropinone reductase homolog At2g29310 Arabidopsis thaliana
P15047 3.34e-27 108 32 6 259 1 entA 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Escherichia coli (strain K12)
Q9ZW20 3.59e-27 108 31 5 257 3 At2g29370 Tropinone reductase homolog At2g29370 Arabidopsis thaliana
P07772 3.9e-27 108 34 6 255 3 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q53217 3.9e-27 112 34 6 252 3 NGR_a01150 Uncharacterized short-chain type dehydrogenase/reductase y4vI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q53217 5.88e-15 77 26 5 252 3 NGR_a01150 Uncharacterized short-chain type dehydrogenase/reductase y4vI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P70720 4.6e-27 107 32 4 253 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Aggregatibacter actinomycetemcomitans
A3LZU7 5.63e-27 108 35 5 259 1 DHG2 L-rhamnose-1-dehydrogenase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q9GKX2 7.96e-27 107 29 4 258 1 DHRS4 Dehydrogenase/reductase SDR family member 4 (Fragment) Oryctolagus cuniculus
P0A9P9 8.28e-27 107 30 4 260 1 idnO 5-keto-D-gluconate 5-reductase Escherichia coli (strain K12)
P0A9Q0 8.28e-27 107 30 4 260 3 idnO 5-keto-D-gluconate 5-reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
F1SWA0 8.38e-27 107 32 4 259 1 ZSD1 Zerumbone synthase Zingiber zerumbet
Q2FVD5 8.68e-27 107 33 2 188 3 SAOUHSC_02778 Uncharacterized oxidoreductase SAOUHSC_02778 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HD73 8.68e-27 107 33 2 188 3 SACOL2488 Uncharacterized oxidoreductase SACOL2488 Staphylococcus aureus (strain COL)
Q2FE21 8.68e-27 107 33 2 188 3 SAUSA300_2422 Uncharacterized oxidoreductase SAUSA300_2422 Staphylococcus aureus (strain USA300)
Q6NUE2 9.13e-27 107 30 5 251 2 cbr4 Carbonyl reductase family member 4 Xenopus laevis
Q2UEK6 1.11e-26 107 31 5 263 2 astEA Short chain dehydrogenase/reductase astE Aspergillus oryzae (strain ATCC 42149 / RIB 40)
O34717 1.8e-26 106 28 3 255 2 fadH Probable 2,4-dienoyl-CoA reductase [(2E)-enoyl-CoA-producing] Bacillus subtilis (strain 168)
Q56841 1.91e-26 106 33 7 257 1 xecE1 2-(S)-hydroxypropyl-CoM dehydrogenase 1 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
W3XAA0 2.11e-26 107 34 5 259 1 PfmaG Tetrahydroxynaphthalene reductase PfmaG Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q9ZW19 2.12e-26 106 30 4 257 1 SDR Tropinone reductase homolog At2g29360 Arabidopsis thaliana
A4IFA7 2.26e-26 105 32 5 251 2 CBR4 3-oxoacyl-[acyl-carrier-protein] reductase Bos taurus
F4IKM1 2.82e-26 107 32 4 257 2 At2g29340 Tropinone reductase homolog At2g29340 Arabidopsis thaliana
O49332 3.14e-26 106 31 4 256 3 At2g30670 Tropinone reductase homolog At2g30670 Arabidopsis thaliana
P55575 3.95e-26 105 31 6 265 3 NGR_a02430 Uncharacterized short-chain type dehydrogenase/reductase y4mP Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9SCU0 4.15e-26 106 30 5 265 3 SDR2a Short-chain dehydrogenase reductase 2a Arabidopsis thaliana
Q9BUT1 5.74e-26 105 33 7 254 1 BDH2 Dehydrogenase/reductase SDR family member 6 Homo sapiens
Q7TS56 6.25e-26 104 32 5 251 2 Cbr4 3-oxoacyl-[acyl-carrier-protein] reductase Rattus norvegicus
A0A3Q8GL18 6.55e-26 105 30 6 259 1 NEPS1 (+)-cis,trans-nepetalactol synthase NEPS1 Nepeta racemosa
P0DOV5 6.8e-26 105 30 5 261 1 PpSQ1_00405 Sulfoquinovose 1-dehydrogenase Pseudomonas putida
Q94KL7 7.84e-26 105 31 6 257 1 None Secoisolariciresinol dehydrogenase (Fragment) Forsythia intermedia
Q06136 8.14e-26 106 34 7 228 1 KDSR 3-ketodihydrosphingosine reductase Homo sapiens
Q91VT4 8.56e-26 104 32 5 251 1 Cbr4 3-oxoacyl-[acyl-carrier-protein] reductase Mus musculus
P50165 8.7e-26 105 30 4 259 2 None Tropinone reductase homolog Datura stramonium
Q5C9I9 8.81e-26 105 32 5 257 1 None (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial Mentha piperita
Q9C826 1.05e-25 105 32 6 262 1 ABA2 Xanthoxin dehydrogenase Arabidopsis thaliana
P95727 1.11e-25 105 30 4 249 1 chcA 1-cyclohexenylcarbonyl-CoA reductase Streptomyces collinus
Q99RF5 1.14e-25 103 32 3 189 3 SAV2478 Uncharacterized oxidoreductase SAV2478 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A3L9 1.14e-25 103 32 3 189 1 SA2266 Uncharacterized oxidoreductase SA2266 Staphylococcus aureus (strain N315)
Q6GDV6 1.5e-25 103 32 3 189 3 SAR2567 Uncharacterized oxidoreductase SAR2567 Staphylococcus aureus (strain MRSA252)
Q56840 1.55e-25 103 30 6 255 1 xecD1 2-(R)-hydroxypropyl-CoM dehydrogenase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P76633 1.58e-25 104 28 3 259 3 ygcW Uncharacterized oxidoreductase YgcW Escherichia coli (strain K12)
Q8N4T8 1.84e-25 103 33 5 251 1 CBR4 3-oxoacyl-[acyl-carrier-protein] reductase Homo sapiens
Q9BTZ2 1.94e-25 104 29 4 258 1 DHRS4 Dehydrogenase/reductase SDR family member 4 Homo sapiens
P39071 2.01e-25 103 32 4 255 1 dhbA 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Bacillus subtilis (strain 168)
Q4UK62 2.19e-25 103 33 4 257 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q2KIJ5 2.3e-25 105 34 7 228 1 KDSR 3-ketodihydrosphingosine reductase Bos taurus
W6QDA7 2.34e-25 104 29 7 275 1 anuF Short-chain dehydrogenase anuF Penicillium roqueforti (strain FM164)
P19992 2.41e-25 103 34 6 254 1 None 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Streptomyces exfoliatus
Q9ZW16 2.48e-25 103 32 5 260 1 TRI Tropinone reductase homolog At2g29330 Arabidopsis thaliana
P25145 2.68e-25 103 31 7 248 3 lmo0432 Uncharacterized oxidoreductase Lmo0432 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
O18404 2.71e-25 103 36 5 202 1 scu 3-hydroxyacyl-CoA dehydrogenase type-2 Drosophila melanogaster
P9WGS3 2.76e-25 107 32 0 185 1 ephD Probable oxidoreductase EphD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGS2 2.76e-25 107 32 0 185 3 ephD Probable oxidoreductase EphD Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66778 2.76e-25 107 32 0 185 3 ephD Probable oxidoreductase EphD Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O31642 3.3e-25 103 31 9 260 3 yjdA Uncharacterized oxidoreductase YjdA Bacillus subtilis (strain 168)
P50171 3.4e-25 103 35 4 259 1 Hsd17b8 (3R)-3-hydroxyacyl-CoA dehydrogenase Mus musculus
Q1JP75 3.47e-25 102 32 5 264 2 DCXR L-xylulose reductase Bos taurus
Q73SC8 3.75e-25 103 32 3 267 1 MAP_4146 Uncharacterized NAD-dependent oxidoreductase MAP_4146 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q5RCF8 4.18e-25 103 29 4 258 2 DHRS4 Dehydrogenase/reductase SDR family member 4 Pongo abelii
Q5HLD8 4.28e-25 102 32 2 187 3 SERP2049 Uncharacterized oxidoreductase SERP2049 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN40 4.28e-25 102 32 2 187 3 SE_2036 Uncharacterized oxidoreductase SE_2036 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P19337 5.17e-25 102 32 9 262 1 baiA2 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 2 Clostridium scindens (strain JCM 10418 / VPI 12708)
Q8NBQ5 6.24e-25 103 29 2 192 1 HSD17B11 Estradiol 17-beta-dehydrogenase 11 Homo sapiens
Q5NVG2 6.64e-25 103 29 2 192 2 HSD17B11 Estradiol 17-beta-dehydrogenase 11 Pongo abelii
P50204 6.78e-25 102 31 3 242 3 phaB Acetoacetyl-CoA reductase Paracoccus denitrificans
Q8K9J5 9.58e-25 101 26 3 256 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8RX32 9.74e-25 102 31 7 260 2 At1g07450 Tropinone reductase homolog At1g07450 Arabidopsis thaliana
Q13268 9.76e-25 102 28 4 253 1 DHRS2 Dehydrogenase/reductase SDR family member 2, mitochondrial Homo sapiens
Q92RN6 1.06e-24 102 30 4 259 3 galD Probable galactose dehydrogenase GalD Rhizobium meliloti (strain 1021)
P70684 1.13e-24 102 33 6 221 2 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Cavia porcellus
O74470 1.16e-24 102 30 4 257 3 SPCC1739.08c Uncharacterized oxidoreductase C1739.08c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q49WS9 1.22e-24 101 32 5 207 3 SSP1627 Uncharacterized oxidoreductase SSP1627 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q42182 1.33e-24 102 30 5 257 2 At2g29300 Tropinone reductase homolog At2g29300 Arabidopsis thaliana
G9FRD7 1.4e-24 101 31 4 258 1 hdha 7alpha-hydroxysteroid dehydrogenase Clostridium sardiniense
Q92GE0 1.44e-24 101 33 4 257 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P9WGS7 2e-24 101 31 4 272 1 Rv0687 Uncharacterized NAD-dependent oxidoreductase Rv0687 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGS6 2e-24 101 31 4 272 3 MT0715 Uncharacterized NAD-dependent oxidoreductase MT0715 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WGT3 2.16e-24 100 31 5 251 1 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGT2 2.16e-24 100 31 5 251 3 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Y5 2.16e-24 100 31 5 251 3 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O80714 2.22e-24 101 30 8 272 3 SDR3c Short-chain dehydrogenase reductase 3c Arabidopsis thaliana
A0A8F5XX49 2.34e-24 101 31 8 266 1 BDH2 (+)-borneol dehydrogenase 2 Salvia officinalis
P07914 2.45e-24 100 32 9 262 1 baiA1 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 1/3 Clostridium scindens (strain JCM 10418 / VPI 12708)
Q920P0 2.59e-24 100 31 4 261 1 Dcxr L-xylulose reductase Rattus norvegicus
G5EGA6 3.19e-24 100 31 6 262 1 dhrs-4 Dehydrogenase/reductase SDR family member 4 Caenorhabditis elegans
Q9Y6Z9 3.24e-24 100 32 7 264 3 sou1 Sorbose reductase sou1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q92EK7 3.53e-24 100 29 6 247 3 lin0452 Uncharacterized oxidoreductase Lin0452 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0A2U8U2K8 4.35e-24 100 29 5 254 1 asL5 Oxidoreductase asL5 Sarocladium schorii
Q9EQ06 4.47e-24 101 28 2 192 1 Hsd17b11 Estradiol 17-beta-dehydrogenase 11 Mus musculus
Q6AYS8 4.7e-24 101 27 2 192 2 Hsd17b11 Estradiol 17-beta-dehydrogenase 11 Rattus norvegicus
Q7SHI4 4.8e-24 100 31 8 275 2 srdC Short-chain dehydrogenase srdC Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q7Z5P4 5.51e-24 100 28 2 192 1 HSD17B13 17-beta-hydroxysteroid dehydrogenase 13 Homo sapiens
P08074 5.96e-24 99 31 4 257 1 Cbr2 Carbonyl reductase [NADPH] 2 Mus musculus
Q9ZW15 6.25e-24 100 30 5 257 2 At2g29320 Tropinone reductase homolog At2g29320 Arabidopsis thaliana
Q9ZW12 6.32e-24 101 28 5 260 2 At2g29260 Tropinone reductase homolog At2g29260, chloroplastic Arabidopsis thaliana
P0DX40 7.09e-24 100 29 5 251 1 cla-dh CLA biosynthesis dehydrogenase/reductase Lactiplantibacillus plantarum
Q91XV4 7.26e-24 99 31 3 257 1 DCXR L-xylulose reductase Mesocricetus auratus
P87219 8.84e-24 100 31 6 259 1 SOU1 Sorbose reductase SOU1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P39644 1.09e-23 99 27 2 255 1 bacG NADPH-dependent reductase BacG Bacillus subtilis (strain 168)
Q8VCR2 1.1e-23 100 30 3 193 1 Hsd17b13 17-beta-hydroxysteroid dehydrogenase 13 Mus musculus
Q6GV12 1.2e-23 100 32 7 228 1 Kdsr 3-ketodihydrosphingosine reductase Mus musculus
Q4JK73 1.23e-23 100 27 2 192 2 HSD17B11 Estradiol 17-beta-dehydrogenase 11 Macaca fascicularis
Q91X52 1.32e-23 99 30 4 261 1 Dcxr L-xylulose reductase Mus musculus
P45375 1.95e-23 98 30 3 238 3 phaB Acetoacetyl-CoA reductase Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Q5M875 2.12e-23 99 30 3 193 1 Hsd17b13 17-beta-hydroxysteroid dehydrogenase 13 Rattus norvegicus
Q68ER2 3.13e-23 97 29 6 253 2 cbr4 Carbonyl reductase family member 4 Xenopus tropicalis
Q51576 3.23e-23 98 34 7 258 3 PA3106 Uncharacterized oxidoreductase PA3106 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P05707 4.07e-23 97 29 3 255 1 srlD Sorbitol-6-phosphate 2-dehydrogenase Escherichia coli (strain K12)
O34782 4.31e-23 97 29 4 261 3 yvrD Uncharacterized oxidoreductase YvrD Bacillus subtilis (strain 168)
G4N1P8 4.48e-23 97 30 5 259 2 ABA4 Short-chain dehydrogenase/reductase ABA4 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
L7I518 4.48e-23 97 30 5 259 2 ABA4 Short-chain dehydrogenase/reductase ABA4 Pyricularia oryzae (strain Y34)
Q7Z4W1 6.61e-23 97 30 4 257 1 DCXR L-xylulose reductase Homo sapiens
P52037 6.73e-23 97 32 7 253 1 ygfF Uncharacterized oxidoreductase YgfF Escherichia coli (strain K12)
F1QWW8 7.58e-23 98 35 4 191 1 kdsr 3-dehydrosphinganine reductase Danio rerio
Q920N9 9.22e-23 96 30 4 261 2 DCXR L-xylulose reductase Cavia porcellus
P71534 9.89e-23 96 31 6 258 1 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P23102 1.07e-22 97 32 7 257 3 xylL 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase Pseudomonas putida
Q9LBV3 1.14e-22 96 28 7 268 1 barS1 A-factor type gamma-butyrolactone 1'-reductase (1S-forming) Streptomyces virginiae
Q9S9W2 1.18e-22 96 31 6 259 1 SDRA Short-chain dehydrogenase/reductase SDRA Arabidopsis thaliana
Q5LA59 1.53e-22 96 28 4 254 1 hdhA 7alpha-hydroxysteroid dehydrogenase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
O32291 1.58e-22 98 31 1 187 3 yxnA Uncharacterized oxidoreductase YxnA Bacillus subtilis (strain 168)
T2KLZ8 1.67e-22 96 28 4 256 2 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q29529 1.68e-22 95 30 5 258 1 CBR2 Carbonyl reductase [NADPH] 2 Sus scrofa
A0A3Q8GYY4 2.28e-22 95 31 11 267 1 NEPS2 (+)-cis,trans-nepetalactol synthase NEPS2 Nepeta racemosa
K4N0V2 2.6e-22 95 31 7 261 1 BDH Borneol dehydrogenase, mitochondrial Lavandula x intermedia
Q3T0C2 2.84e-22 95 34 6 208 2 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Bos taurus
P15428 3.91e-22 95 33 5 207 1 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Homo sapiens
Q6CEE9 4.41e-22 95 28 5 261 1 YALI0B16192g Probable NADP-dependent mannitol dehydrogenase Yarrowia lipolytica (strain CLIB 122 / E 150)
Q8MJY8 4.71e-22 95 33 5 207 2 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Macaca fascicularis
Q56632 5.17e-22 95 30 5 262 3 vibA Vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1NEI6 5.52e-22 94 28 6 253 1 LRA5 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)) Sphingomonas sp. (strain SKA58)
P9WES5 6.42e-22 95 31 8 275 3 fogB Short-chain dehydrogenase fogB Aspergillus ruber (strain CBS 135680)
O80713 1.27e-21 94 30 5 263 2 SDR3a Short-chain dehydrogenase reductase 3a Arabidopsis thaliana
P9WGS5 1.38e-21 94 29 6 275 1 Rv2750 Uncharacterized oxidoreductase Rv2750 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGS4 1.38e-21 94 29 6 275 3 MT2820 Uncharacterized oxidoreductase MT2820 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P50160 1.82e-21 94 31 8 282 2 TS2 Sex determination protein tasselseed-2 Zea mays
Q6NV34 1.94e-21 94 29 5 256 2 decr2 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] Danio rerio
O93868 2.17e-21 93 27 3 263 1 mtdH NADP-dependent mannitol dehydrogenase Agaricus bisporus
Q7FAE1 2.36e-21 93 31 6 260 2 Os04g0179200 Momilactone A synthase Oryza sativa subsp. japonica
H9BFQ1 2.61e-21 93 30 11 272 2 None Tropinone reductase-like 2 Erythroxylum coca
N4WE73 2.71e-21 92 28 7 234 3 OXI1 Dehydrogenase OXI1 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
O31767 3.04e-21 92 30 6 252 3 ymfI Uncharacterized oxidoreductase YmfI Bacillus subtilis (strain 168)
Q4L8Y1 3.63e-21 92 30 2 190 3 SH0585 Uncharacterized oxidoreductase SH0585 Staphylococcus haemolyticus (strain JCSC1435)
Q9M1K9 4.69e-21 92 32 7 262 1 TA1 Short-chain dehydrogenase reductase ATA1 Arabidopsis thaliana
Q8VCC1 5.19e-21 92 33 5 207 1 Hpgd 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Mus musculus
A7IQF2 5.28e-21 91 35 5 199 3 xecE2 Inactive 2-(S)-hydroxypropyl-CoM dehydrogenase 2 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P27582 5.39e-21 90 33 4 203 1 None 3-oxoacyl-[acyl-carrier-protein] reductase (Fragments) Brassica napus
B8H1Z0 6.47e-21 91 31 4 254 1 xylB D-xylose 1-dehydrogenase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A9Z0 6.47e-21 91 31 4 254 1 xylB D-xylose 1-dehydrogenase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1RKB7 7.81e-21 91 30 7 236 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia bellii (strain RML369-C)
P57432 8.02e-21 91 26 4 256 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P39333 1.12e-20 90 28 8 255 1 bdcA Cyclic-di-GMP-binding biofilm dispersal mediator protein Escherichia coli (strain K12)
P16543 1.18e-20 90 33 9 250 3 gra-orf6 Granaticin polyketide synthase putative ketoacyl reductase 2 Streptomyces violaceoruber
F4J300 1.21e-20 91 31 5 261 3 SDR5 Short-chain dehydrogenase reductase 5 Arabidopsis thaliana
G4N290 1.39e-20 91 32 11 281 2 RED2 Short-chain dehydrogenase RED2 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
M2ZIX7 1.47e-20 92 27 6 252 3 MYCFIDRAFT_6125 Short chain dehydrogenase MYCFIDRAFT_6125 Pseudocercospora fijiensis (strain CIRAD86)
P54554 1.71e-20 90 30 5 235 3 yqjQ Uncharacterized oxidoreductase YqjQ Bacillus subtilis (strain 168)
P14697 3.21e-20 89 27 3 255 1 phaB Acetoacetyl-CoA reductase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P71079 3.32e-20 89 27 5 255 1 fabL Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL Bacillus subtilis (strain 168)
P73826 3.5e-20 89 29 5 255 1 phaB Acetoacetyl-CoA reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8KES3 3.61e-20 89 29 3 208 1 CT0609 Sepiapterin reductase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q05016 4.84e-20 89 32 5 198 1 YMR226C NADP-dependent 3-hydroxy acid dehydrogenase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5RCH8 4.85e-20 90 26 7 269 2 PECR Peroxisomal trans-2-enoyl-CoA reductase Pongo abelii
H9BFQ0 5e-20 89 30 8 262 2 None Tropinone reductase-like 1 Erythroxylum coca
Q9BY49 5.21e-20 90 25 5 265 1 PECR Peroxisomal trans-2-enoyl-CoA reductase Homo sapiens
Q9MYP6 5.81e-20 89 30 5 252 2 HSD17B14 17-beta-hydroxysteroid dehydrogenase 14 Bos taurus
P9WGP9 6.74e-20 89 33 2 191 2 sadH Putative oxidoreductase SadH Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGP8 6.74e-20 89 33 2 191 3 sadH Putative oxidoreductase SadH Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8N3Y7 7.51e-20 90 31 5 198 1 SDR16C5 Epidermal retinol dehydrogenase 2 Homo sapiens
A5PJJ7 9.87e-20 89 30 4 198 2 SDR16C6 Short-chain dehydrogenase/reductase family 16C member 6 Bos taurus
O07399 1.23e-19 88 28 5 258 3 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium avium
A0A3Q8GLE8 1.66e-19 88 28 9 264 1 NEPS3 (+)-cis,cis-nepetalactol synthase NEPS3 Nepeta racemosa
Q9XT00 1.85e-19 88 32 5 261 3 HSD17B8 (3R)-3-hydroxyacyl-CoA dehydrogenase Sus scrofa
A0A8F5SIS3 2.74e-19 87 29 9 269 1 BDH1 (+)-borneol dehydrogenase 1 Salvia officinalis
Q7TQA3 3.02e-19 88 30 4 200 2 Sdr16c5 Epidermal retinol dehydrogenase 2 Mus musculus
O02691 3.42e-19 87 30 3 209 1 HSD17B10 3-hydroxyacyl-CoA dehydrogenase type-2 Bos taurus
A0A8D5M6H6 3.61e-19 87 29 9 264 1 esdpF Short-chain dehydrogenase/reductase esdpF Penicillium shearii
Q56318 3.67e-19 87 30 3 258 3 TM_0019 Uncharacterized oxidoreductase TM_0019 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9SY73 3.71e-19 87 32 4 188 1 At1g10310 NADPH-dependent pterin aldehyde reductase Arabidopsis thaliana
F4J2Z7 3.99e-19 87 31 7 266 2 SDR4 Short-chain dehydrogenase reductase 4 Arabidopsis thaliana
Q9BPX1 4.13e-19 87 29 6 230 1 HSD17B14 17-beta-hydroxysteroid dehydrogenase 14 Homo sapiens
I6Y778 4.15e-19 89 30 6 252 1 fabG4 3-oxoacyl-[acyl-carrier-protein] reductase [NADH] Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A1B2CTA9 5.36e-19 87 28 11 271 1 penD Short chain dehydrogenase penD Penicillium thymicola
P0AET8 6.46e-19 86 28 4 255 1 hdhA 7alpha-hydroxysteroid dehydrogenase Escherichia coli (strain K12)
P0AET9 6.46e-19 86 28 4 255 3 hdhA 7alpha-hydroxysteroid dehydrogenase Escherichia coli O157:H7
Q46381 6.49e-19 87 32 12 270 1 bphB Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Comamonas testosteroni
Q9WVK3 8.14e-19 87 27 8 266 2 Pecr Peroxisomal trans-2-enoyl-CoA reductase Rattus norvegicus
Q99714 8.66e-19 86 28 7 267 1 HSD17B10 3-hydroxyacyl-CoA dehydrogenase type-2 Homo sapiens
Q70FD1 1.44e-18 85 28 9 270 1 ALX1 NADH-dependent L-xylulose reductase Ambrosiozyma monospora
P22441 2.03e-18 85 31 5 260 1 None N-acylmannosamine 1-dehydrogenase Flavobacterium sp. (strain 141-8)
D2WKD9 2.28e-18 84 30 4 197 1 SDR-1 Farnesol dehydrogenase Aedes aegypti
Q5RA68 2.43e-18 87 28 6 263 2 HSDL2 Hydroxysteroid dehydrogenase-like protein 2 Pongo abelii
Q9STY8 3.14e-18 85 31 5 207 3 HSD2 11-beta-hydroxysteroid dehydrogenase-like 2 Arabidopsis thaliana
P0CU00 4.23e-18 84 30 6 213 3 SPAC977.08 Uncharacterized oxidoreductase SPAC977.08 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P0CU01 4.23e-18 84 30 6 213 3 SPAC1348.09 Uncharacterized oxidoreductase SPBC1348.09 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P05406 4.86e-18 84 28 8 259 3 fixR Protein FixR Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
F4JZN6 5.12e-18 85 32 3 183 1 TSC10B 3-dehydrosphinganine reductase TSC10B Arabidopsis thaliana
G0RNA2 5.24e-18 84 25 10 297 1 lxr4 L-xylo-3-hexulose reductase Hypocrea jecorina (strain QM6a)
P00335 5.3e-18 84 30 5 241 1 rbtD Ribitol 2-dehydrogenase Klebsiella aerogenes
Q6YN16 5.33e-18 85 31 4 192 1 HSDL2 Hydroxysteroid dehydrogenase-like protein 2 Homo sapiens
P50200 5.42e-18 84 27 7 258 1 None 7alpha-hydroxysteroid dehydrogenase Paraclostridium sordellii
Q7T2D1 6.2e-18 85 27 6 217 2 rdh10b Retinol dehydrogenase 10-B Danio rerio
Q9P7B4 6.23e-18 84 30 7 237 1 SPAC521.03 NADP-dependent 3-hydroxy acid dehydrogenase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9STY7 7.98e-18 84 32 4 189 3 HSD3 11-beta-hydroxysteroid dehydrogenase-like 3 Arabidopsis thaliana
O00058 1.17e-17 83 27 4 259 2 PIG8 Probable NADP-dependent mannitol dehydrogenase Uromyces fabae
A0QYC2 1.23e-17 83 32 3 253 1 dthD D-threitol dehydrogenase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q22230 1.4e-17 83 29 7 258 3 decr-1.3 Probable 2,4-dienoyl-CoA reductase 3 [(3E)-enoyl-CoA-producing] Caenorhabditis elegans
Q93W57 1.55e-17 84 32 7 193 1 SOP2 11-beta-hydroxysteroid dehydrogenase A Sesamum indicum
Q05A13 1.58e-17 83 27 4 200 2 Sdr16c6 Short-chain dehydrogenase/reductase family 16C member 6 Mus musculus
P28845 2.03e-17 83 28 7 241 1 HSD11B1 11-beta-hydroxysteroid dehydrogenase 1 Homo sapiens
Q9LUE4 2.81e-17 83 33 6 196 2 HSD6 11-beta-hydroxysteroid dehydrogenase-like 6 Arabidopsis thaliana
P57793 3.26e-17 82 27 4 266 1 SAMN02910417_01454 Phloroglucinol reductase Eubacterium oxidoreducens
O53547 3.29e-17 82 29 8 267 1 chsB1 Hydroxyacyl-CoA dehydrogenase ChsB1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O34896 3.37e-17 82 26 6 276 2 uxuB Uncharacterized oxidoreductase UxuB Bacillus subtilis (strain 168)
Q29608 4e-17 82 27 8 264 1 HSD11B1 11-beta-hydroxysteroid dehydrogenase 1 Saimiri sciureus
A5JYX5 4.11e-17 82 27 2 195 1 dhs-3 Protein dhs-3 Caenorhabditis elegans
G9N4B1 4.18e-17 81 29 8 271 1 virB Short-chain dehydrogenase virB Hypocrea virens (strain Gv29-8 / FGSC 10586)
Q6P3L6 4.81e-17 82 31 5 195 2 hsd17b12a Very-long-chain 3-oxoacyl-CoA reductase-A Danio rerio
Q9CQ62 6.22e-17 82 27 5 256 1 Decr1 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial Mus musculus
Q71R50 6.48e-17 80 30 5 195 2 DHRS11 Dehydrogenase/reductase SDR family member 11 Gallus gallus
O70351 6.68e-17 81 26 7 270 1 Hsd17b10 3-hydroxyacyl-CoA dehydrogenase type-2 Rattus norvegicus
Q0WRJ2 7.99e-17 81 30 5 234 1 TSC10A 3-dehydrosphinganine reductase TSC10A Arabidopsis thaliana
E3VWK2 9.49e-17 80 28 1 194 3 penF 1-deoxy-11-beta-hydroxypentalenate dehydrogenase Streptomyces exfoliatus
G0RH19 1.19e-16 80 26 7 277 1 lxr3 L-xylulose reductase Hypocrea jecorina (strain QM6a)
Q6DCT3 1.22e-16 81 26 6 222 2 rdh10-a Retinol dehydrogenase 10-A Xenopus laevis
H1VN83 1.22e-16 80 28 8 247 1 dpchG Short chain dehydrogenase/reductase dpchG Colletotrichum higginsianum (strain IMI 349063)
Q7M3I4 1.73e-16 80 32 7 228 1 HSD11B1 11-beta-hydroxysteroid dehydrogenase 1 Oryctolagus cuniculus
P87218 1.99e-16 80 26 7 259 3 SOU2 Sorbose reductase homolog SOU2 Candida albicans (strain SC5314 / ATCC MYA-2876)
O08756 2.09e-16 79 30 5 210 1 Hsd17b10 3-hydroxyacyl-CoA dehydrogenase type-2 Mus musculus
P9WGQ5 2.19e-16 79 29 7 260 1 Rv0927c Uncharacterized oxidoreductase Rv0927c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGQ4 2.19e-16 79 29 7 260 3 MT0954 Uncharacterized oxidoreductase MT0954 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q94K41 2.25e-16 79 29 8 256 2 SDR3b Short-chain dehydrogenase reductase 3b Arabidopsis thaliana
Q64591 2.31e-16 80 26 5 256 1 Decr1 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial Rattus norvegicus
Q9RPT1 2.4e-16 79 30 9 273 1 rhlG Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P31808 2.52e-16 79 27 7 249 1 yciK Uncharacterized oxidoreductase YciK Escherichia coli (strain K12)
Q9LUF2 2.71e-16 80 28 6 245 2 HSD7 11-beta-hydroxysteroid dehydrogenase-like 4B Arabidopsis thaliana
P0DKC7 2.71e-16 80 28 6 245 2 HSD4 11-beta-hydroxysteroid dehydrogenase-like 4A Arabidopsis thaliana
Q2TPA8 2.94e-16 81 29 4 192 1 Hsdl2 Hydroxysteroid dehydrogenase-like protein 2 Mus musculus
P44481 3.1e-16 79 25 5 273 1 HI_0048 Uncharacterized oxidoreductase HI_0048 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WEW9 3.92e-16 79 28 5 194 1 dpfgG Short chain dehydrogenase/reductase dpfgG Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q7Q732 4.51e-16 79 26 7 249 3 AGAP005532 Dehydrogenase/reductase SDR family protein 7-like Anopheles gambiae
A4FUZ6 6.58e-16 80 29 4 192 2 HSDL2 Hydroxysteroid dehydrogenase-like protein 2 Bos taurus
Q1MLL4 6.6e-16 78 27 7 259 1 gdh Galactitol 2-dehydrogenase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P0DKC6 7.81e-16 79 30 5 194 1 HSD1 11-beta-hydroxysteroid dehydrogenase 1B Arabidopsis thaliana
P0DKC5 7.81e-16 79 30 5 194 1 HSD1 11-beta-hydroxysteroid dehydrogenase 1A Arabidopsis thaliana
P47230 8.05e-16 78 29 8 268 3 bphB Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Rhodococcus globerulus
P50172 8.5e-16 78 29 9 245 1 Hsd11b1 11-beta-hydroxysteroid dehydrogenase 1 Mus musculus
A0A165U5V5 1e-15 78 27 8 265 1 ADH1 Short chain aldehyde dehydrogenase 1 Euphorbia lathyris
Q5XGF7 1.07e-15 79 25 6 222 2 rdh10 Retinol dehydrogenase 10 Xenopus tropicalis
A0A8J9S3B0 1.09e-15 78 26 5 277 3 phomF Short-chain dehydrogenase/reductase PhomF Diaporthe leptostromiformis
Q6UWP2 1.12e-15 77 27 7 242 1 DHRS11 Dehydrogenase/reductase SDR family member 11 Homo sapiens
A0A162J3X8 1.33e-15 77 26 6 253 1 citE Short chain dehydrogenase citE Monascus ruber
A0A144Y7G4 1.33e-15 77 26 6 253 1 mpl6 Short chain dehydrogenase mpl6 Monascus purpureus
Q28IU1 1.38e-15 78 30 4 193 2 hsd17b12 Very-long-chain 3-oxoacyl-CoA reductase Xenopus tropicalis
Q01198 1.74e-15 77 29 1 185 3 ligD C alpha-dehydrogenase Sphingobium sp. (strain NBRC 103272 / SYK-6)
Q4V8F9 1.8e-15 79 29 4 192 2 Hsdl2 Hydroxysteroid dehydrogenase-like protein 2 Rattus norvegicus
Q96LJ7 1.92e-15 77 28 8 249 1 DHRS1 Dehydrogenase/reductase SDR family member 1 Homo sapiens
Q99L04 2e-15 77 28 8 250 1 Dhrs1 Dehydrogenase/reductase SDR family member 1 Mus musculus
Q6R0J2 2.1e-15 77 29 5 231 1 HSD11B1 11-beta-hydroxysteroid dehydrogenase 1 Mesocricetus auratus
Q8LKV5 2.39e-15 78 27 9 276 1 SOP3 11-beta-hydroxysteroid dehydrogenase B Sesamum indicum
P06235 2.51e-15 76 26 5 254 3 nodG Nodulation protein G Rhizobium meliloti
P9WEQ5 2.65e-15 76 28 8 259 3 olcF Short-chain dehydrogenase/reductase olcF Penicillium canescens
O54753 2.81e-15 77 30 6 195 1 Hsd17b6 17-beta-hydroxysteroid dehydrogenase type 6 Rattus norvegicus
O32229 3.31e-15 76 26 6 268 3 yvaG Uncharacterized oxidoreductase YvaG Bacillus subtilis (strain 168)
P50166 3.75e-15 76 26 6 269 1 ARD D-arabinitol 2-dehydrogenase [ribulose-forming] Candida tropicalis
G3YG17 4.05e-15 76 27 9 295 1 lxrA L-xylulose reductase Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A3F5F0 4.19e-15 76 28 10 239 1 SDH Secoisolariciresinol dehydrogenase Sinopodophyllum hexandrum
A6SSW9 4.19e-15 76 29 3 187 2 BOA17 Oxidoreductase BOA17 Botryotinia fuckeliana (strain B05.10)
A1L1W4 4.58e-15 77 25 6 220 2 rdh10a Retinol dehydrogenase 10-A Danio rerio
C5FTN0 4.64e-15 75 28 9 264 3 easD Chanoclavine-I dehydrogenase easD Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
P50203 4.98e-15 75 30 4 253 3 phaB Acetoacetyl-CoA reductase Acinetobacter sp. (strain RA3849)
Q01373 5.06e-15 77 31 6 240 1 fox-2 Peroxisomal hydratase-dehydrogenase-epimerase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q01373 3.97e-11 66 30 7 214 1 fox-2 Peroxisomal hydratase-dehydrogenase-epimerase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A0A142I726 5.17e-15 76 26 5 269 3 PhomF' Short-chain dehydrogenase/reductase PhomF' Diaporthe leptostromiformis
P37079 5.83e-15 75 27 5 269 3 sorD Sorbitol-6-phosphate 2-dehydrogenase Klebsiella pneumoniae
P51659 6.24e-15 77 34 4 194 1 HSD17B4 Peroxisomal multifunctional enzyme type 2 Homo sapiens
P25970 6.86e-15 75 26 1 190 3 MXAN_5909 Uncharacterized oxidoreductase MXAN_5909 Myxococcus xanthus (strain DK1622)
O08699 7.46e-15 75 33 5 207 1 Hpgd 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Rattus norvegicus
P0CG22 9.41e-15 75 25 6 262 5 DHRS4L1 Putative dehydrogenase/reductase SDR family member 4-like 1 Homo sapiens
Q3ZBV9 9.53e-15 75 27 7 239 2 DHRS11 Dehydrogenase/reductase SDR family member 11 Bos taurus
Q9FYL6 1e-14 75 29 9 247 2 KCR2 Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 Arabidopsis thaliana
Q6F7B8 1.04e-14 75 28 2 193 1 acr1 Fatty acyl-CoA reductase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6PAY8 1.07e-14 76 29 4 192 2 hsdl2 Hydroxysteroid dehydrogenase-like protein 2 Xenopus laevis
Q8NK50 1.1e-14 75 27 6 265 1 lxr1 NADP-dependent mannitol dehydrogenase Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30)
O34308 1.2e-14 74 25 7 257 3 ytkK Putative oxidoreductase YtkK Bacillus subtilis (strain 168)
P13859 1.24e-14 75 30 10 270 1 todD Cis-toluene dihydrodiol dehydrogenase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P08088 1.24e-14 75 30 10 270 3 bnzE Cis-1,2-dihydrobenzene-1,2-diol dehydrogenase Pseudomonas putida
Q3U0B3 1.47e-14 74 27 8 242 1 Dhrs11 Dehydrogenase/reductase SDR family member 11 Mus musculus
Q82IY9 1.67e-14 74 28 3 198 1 ptlF 1-deoxy-11-beta-hydroxypentalenate dehydrogenase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P16232 1.68e-14 74 29 9 245 1 Hsd11b1 11-beta-hydroxysteroid dehydrogenase 1 Rattus norvegicus
Q8A945 1.7e-14 74 30 5 204 1 kdsr 3-ketodihydrosphingosine reductase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8HZJ8 1.71e-14 74 27 5 242 1 None 11-beta-hydroxysteroid dehydrogenase 1 Bos taurus
P43066 1.77e-14 74 25 6 271 3 ARD1 D-arabinitol 2-dehydrogenase [ribulose-forming] Candida albicans (strain WO-1)
Q94KL8 1.86e-14 74 27 9 239 1 None Secoisolariciresinol dehydrogenase (Fragment) Podophyllum peltatum
O74628 2.02e-14 74 23 4 243 3 SPCC162.03 Uncharacterized oxidoreductase C162.03 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q6NRV4 2.13e-14 75 23 6 222 2 rdh10-b Retinol dehydrogenase 10-B Xenopus laevis

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08945
Feature type CDS
Gene -
Product acetoin reductase
Location 1857269 - 1858048 (strand: -1)
Length 780 (nucleotides) / 259 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_877
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00106 short chain dehydrogenase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1028 Lipid transport and metabolism (I) I NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03366 meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304] Butanoate metabolism
Biosynthesis of secondary metabolites		 -

Protein Sequence

MSLTGKAVLVTGAAQGIGRGIALRLAKEGADIALVDLKEESLAKVKKEVEALGRKAVTLIADISQRDQVFAVVEKAEKALGGFDVMVNNAGIAQVKAIEDVRPEDMERIFRINVDGTMWGIQAAAAKFKARGQKGKIINASSIAGHDGFALLGVYSATKFAVRALTQAAAKEFASSGITVNAYCPGIVGTDMWVEIDERFSEITGAPKGETYKKYVDGIALGRAQTPDDVAALVSFLASDDSDYITGQAILTDGGIVYR

Flanking regions ( +/- flanking 50bp)

AATAATTATTAATATCATAACGAAATACCTCACTCACATAGGAGCACACAATGTCACTAACGGGTAAAGCGGTTCTGGTCACCGGCGCTGCACAGGGAATTGGTCGTGGTATTGCATTACGGTTGGCAAAAGAGGGTGCAGATATTGCCCTGGTTGACCTGAAAGAAGAAAGTCTGGCAAAGGTTAAAAAAGAAGTGGAAGCGCTGGGACGTAAAGCCGTCACATTAATCGCGGATATCAGTCAGCGTGATCAGGTTTTTGCTGTGGTGGAAAAGGCTGAAAAAGCACTGGGCGGTTTTGATGTCATGGTAAATAATGCCGGTATTGCCCAGGTGAAAGCAATTGAAGATGTGCGGCCTGAAGATATGGAGCGCATTTTCCGCATCAACGTTGACGGCACTATGTGGGGCATCCAGGCGGCGGCGGCAAAATTCAAAGCACGCGGACAGAAAGGGAAAATCATTAACGCCTCATCTATCGCAGGGCATGATGGTTTCGCCTTGCTTGGCGTGTATTCAGCCACAAAATTTGCCGTGCGTGCATTGACTCAGGCAGCGGCAAAAGAGTTTGCCAGCAGCGGTATTACTGTGAATGCTTACTGTCCGGGGATTGTCGGTACGGATATGTGGGTTGAAATAGATGAACGTTTCTCTGAGATTACCGGTGCGCCGAAAGGGGAAACCTACAAAAAATATGTCGATGGGATAGCACTTGGTCGCGCTCAAACCCCTGATGATGTCGCAGCGCTGGTATCGTTCCTGGCAAGCGATGATTCAGATTACATCACCGGTCAGGCTATTTTGACCGACGGTGGTATTGTTTACCGCTAGGTAACATCGTCACATTAGTCAGTTACACTGATAATCGGGTCCGCTCTGTC