Homologs in group_914

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04275 FBDBKF_04275 63.6 Morganella morganii S1 zapD cell division protein ZapD
EHELCC_05565 EHELCC_05565 63.6 Morganella morganii S2 zapD cell division protein ZapD
NLDBIP_05885 NLDBIP_05885 63.6 Morganella morganii S4 zapD cell division protein ZapD
LHKJJB_02765 LHKJJB_02765 63.6 Morganella morganii S3 zapD cell division protein ZapD
HKOGLL_06240 HKOGLL_06240 63.6 Morganella morganii S5 zapD cell division protein ZapD
F4V73_RS08720 F4V73_RS08720 60.8 Morganella psychrotolerans zapD cell division protein ZapD

Distribution of the homologs in the orthogroup group_914

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_914

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F0Z5 0.0 510 100 0 250 3 zapD Cell division protein ZapD Proteus mirabilis (strain HI4320)
P60013 1.06e-108 316 60 0 250 3 zapD Cell division protein ZapD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G9T9 5.46e-102 299 53 0 250 3 zapD Cell division protein ZapD Serratia proteamaculans (strain 568)
C6DET1 1.43e-101 298 54 0 250 3 zapD Cell division protein ZapD Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D0J5 3.9e-99 292 53 0 250 3 zapD Cell division protein ZapD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JJK6 7.22e-98 289 55 0 250 3 zapD Cell division protein ZapD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7NHK6 2.39e-97 287 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B2U2A7 1.13e-96 286 53 0 245 3 zapD Cell division protein ZapD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RG94 1.13e-96 286 53 0 245 3 zapD Cell division protein ZapD Escherichia coli (strain UTI89 / UPEC)
B1LG38 1.13e-96 286 53 0 245 3 zapD Cell division protein ZapD Escherichia coli (strain SMS-3-5 / SECEC)
Q8FL56 1.13e-96 286 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLN8 1.13e-96 286 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7E5 1.13e-96 286 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O1:K1 / APEC
B7MNV9 1.13e-96 286 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O81 (strain ED1a)
B7MAM4 1.13e-96 286 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIF1 1.13e-96 286 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7FM54 1.21e-96 286 55 0 250 3 zapD Cell division protein ZapD Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q32JZ0 1.27e-96 285 53 0 245 3 zapD Cell division protein ZapD Shigella dysenteriae serotype 1 (strain Sd197)
B1JK67 1.74e-96 285 55 0 250 3 zapD Cell division protein ZapD Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EJ2 1.74e-96 285 55 0 250 3 zapD Cell division protein ZapD Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPS4 1.74e-96 285 55 0 250 3 zapD Cell division protein ZapD Yersinia pestis (strain Pestoides F)
Q1CLZ0 1.74e-96 285 55 0 250 3 zapD Cell division protein ZapD Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1J6 1.74e-96 285 55 0 250 3 zapD Cell division protein ZapD Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBH9 1.74e-96 285 55 0 250 3 zapD Cell division protein ZapD Yersinia pestis
B2K4G0 1.74e-96 285 55 0 250 3 zapD Cell division protein ZapD Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3S8 1.74e-96 285 55 0 250 3 zapD Cell division protein ZapD Yersinia pestis bv. Antiqua (strain Antiqua)
Q326D3 1.83e-96 285 53 0 245 3 zapD Cell division protein ZapD Shigella boydii serotype 4 (strain Sb227)
Q3Z5Q7 2.38e-96 285 53 0 245 3 zapD Cell division protein ZapD Shigella sonnei (strain Ss046)
B6HZ79 2.38e-96 285 53 0 245 3 zapD Cell division protein ZapD Escherichia coli (strain SE11)
P36680 2.38e-96 285 53 0 245 1 zapD Cell division protein ZapD Escherichia coli (strain K12)
B1IR77 2.38e-96 285 53 0 245 3 zapD Cell division protein ZapD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZW53 2.38e-96 285 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O9:H4 (strain HS)
B1XC78 2.38e-96 285 53 0 245 3 zapD Cell division protein ZapD Escherichia coli (strain K12 / DH10B)
C4ZRJ6 2.38e-96 285 53 0 245 3 zapD Cell division protein ZapD Escherichia coli (strain K12 / MC4100 / BW2952)
B7M143 2.38e-96 285 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O8 (strain IAI1)
B7LFX0 2.38e-96 285 53 0 245 3 zapD Cell division protein ZapD Escherichia coli (strain 55989 / EAEC)
B7N7X3 2.51e-96 285 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7LWG7 3.16e-96 285 51 0 245 3 zapD Cell division protein ZapD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q83MF4 6.78e-96 284 53 0 245 3 zapD Cell division protein ZapD Shigella flexneri
Q0T896 6.78e-96 284 53 0 245 3 zapD Cell division protein ZapD Shigella flexneri serotype 5b (strain 8401)
B5YZD7 1.04e-95 283 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X988 1.04e-95 283 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O157:H7
B4SU61 2.31e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella newport (strain SL254)
Q57TB7 2.31e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella choleraesuis (strain SC-B67)
P67693 2.58e-94 280 51 0 245 1 zapD Cell division protein ZapD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67694 2.58e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella typhi
B4TXI8 2.58e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella schwarzengrund (strain CVM19633)
B5BLD5 2.58e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella paratyphi A (strain AKU_12601)
Q5PDD7 2.58e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TJ98 2.58e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella heidelberg (strain SL476)
B5RH77 2.58e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2N7 2.58e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella enteritidis PT4 (strain P125109)
B5FI84 2.58e-94 280 51 0 245 3 zapD Cell division protein ZapD Salmonella dublin (strain CT_02021853)
A8ALJ5 3.47e-94 279 51 0 245 3 zapD Cell division protein ZapD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MQA5 1.15e-93 278 51 0 245 3 zapD Cell division protein ZapD Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7ZHJ3 6.41e-93 276 53 0 245 3 zapD Cell division protein ZapD Escherichia coli O139:H28 (strain E24377A / ETEC)
A4W6K4 7.8e-93 276 50 0 246 3 zapD Cell division protein ZapD Enterobacter sp. (strain 638)
B2VD53 1.05e-92 276 52 0 246 3 zapD Cell division protein ZapD Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MIG0 1.95e-92 275 50 0 245 3 zapD Cell division protein ZapD Cronobacter sakazakii (strain ATCC BAA-894)
B5Y1T6 1.17e-91 273 52 0 245 3 zapD Cell division protein ZapD Klebsiella pneumoniae (strain 342)
A6T4P4 1.9e-90 270 51 0 245 3 zapD Cell division protein ZapD Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5F7X6 3.73e-90 269 51 0 245 3 zapD Cell division protein ZapD Salmonella agona (strain SL483)
Q6LMG6 2.17e-62 198 39 1 241 3 zapD Cell division protein ZapD Photobacterium profundum (strain SS9)
P67696 2.1e-61 196 37 1 245 3 zapD Cell division protein ZapD Vibrio vulnificus (strain YJ016)
P67695 2.1e-61 196 37 1 245 3 zapD Cell division protein ZapD Vibrio vulnificus (strain CMCP6)
B7VK24 6.75e-60 192 36 1 241 3 zapD Cell division protein ZapD Vibrio atlanticus (strain LGP32)
Q87LT3 2.32e-58 188 36 1 245 1 zapD Cell division protein ZapD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LQX1 1.53e-57 186 35 1 245 3 zapD Cell division protein ZapD Vibrio cholerae serotype O1 (strain M66-2)
Q9KPE2 1.53e-57 186 35 1 245 3 zapD Cell division protein ZapD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5K1 1.53e-57 186 35 1 245 3 zapD Cell division protein ZapD Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q5R0N4 6.27e-49 164 35 3 251 3 zapD Cell division protein ZapD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q8EJQ0 8.16e-48 161 34 4 246 3 zapD Cell division protein ZapD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5E2R1 4.51e-47 159 34 1 241 3 zapD Cell division protein ZapD Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6ELG5 1.1e-46 158 34 1 241 3 zapD Cell division protein ZapD Aliivibrio salmonicida (strain LFI1238)
B8E665 1.3e-43 150 35 4 246 3 zapD Cell division protein ZapD Shewanella baltica (strain OS223)
A6WTC8 1.4e-43 150 35 4 246 3 zapD Cell division protein ZapD Shewanella baltica (strain OS185)
Q0HQL6 1.66e-43 150 35 4 246 3 zapD Cell division protein ZapD Shewanella sp. (strain MR-7)
Q0HN71 3.42e-43 149 34 4 246 3 zapD Cell division protein ZapD Shewanella sp. (strain MR-4)
Q82WR3 2.4e-41 145 31 3 250 3 zapD Cell division protein ZapD Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0AH80 6.67e-40 141 31 3 248 3 zapD Cell division protein ZapD Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q606C7 3.16e-37 134 30 4 249 3 zapD Cell division protein ZapD Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5P2L5 2.19e-34 127 28 4 251 3 zapD Cell division protein ZapD Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q479P4 1.61e-33 124 29 2 225 3 zapD Cell division protein ZapD Dechloromonas aromatica (strain RCB)
A1K3E2 7.05e-33 123 27 4 248 3 zapD Cell division protein ZapD Azoarcus sp. (strain BH72)
Q13U06 3.62e-32 121 25 3 248 3 zapD Cell division protein ZapD Paraburkholderia xenovorans (strain LB400)
A9I1I9 3.77e-32 121 27 4 250 3 zapD Cell division protein ZapD Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A6T2E3 5.42e-32 120 27 3 248 3 zapD Cell division protein ZapD Janthinobacterium sp. (strain Marseille)
P67690 8.97e-32 120 28 4 253 3 zapD Cell division protein ZapD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P67692 8.97e-32 120 28 4 253 3 zapD Cell division protein ZapD Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P67691 8.97e-32 120 28 4 253 3 zapD Cell division protein ZapD Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2SZG9 1.19e-31 119 25 3 248 3 zapD Cell division protein ZapD Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B2SYW1 1.92e-31 119 25 3 248 3 zapD Cell division protein ZapD Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q63QL1 2.47e-31 119 25 3 248 3 zapD Cell division protein ZapD Burkholderia pseudomallei (strain K96243)
A3NDU9 2.47e-31 119 25 3 248 3 zapD Cell division protein ZapD Burkholderia pseudomallei (strain 668)
Q3JNF2 2.47e-31 119 25 3 248 3 zapD Cell division protein ZapD Burkholderia pseudomallei (strain 1710b)
A3NZK0 2.47e-31 119 25 3 248 3 zapD Cell division protein ZapD Burkholderia pseudomallei (strain 1106a)
A1V0Q3 2.47e-31 119 25 3 248 3 zapD Cell division protein ZapD Burkholderia mallei (strain SAVP1)
Q62GU2 2.47e-31 119 25 3 248 3 zapD Cell division protein ZapD Burkholderia mallei (strain ATCC 23344)
A2S5S9 2.47e-31 119 25 3 248 3 zapD Cell division protein ZapD Burkholderia mallei (strain NCTC 10229)
A3MR78 2.47e-31 119 25 3 248 3 zapD Cell division protein ZapD Burkholderia mallei (strain NCTC 10247)
B2JHE6 4.72e-31 118 25 3 248 3 zapD Cell division protein ZapD Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A9AI82 5.53e-31 118 25 3 248 3 zapD Cell division protein ZapD Burkholderia multivorans (strain ATCC 17616 / 249)
A4JBA8 7.52e-31 117 25 3 248 3 zapD Cell division protein ZapD Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q39JV6 9.59e-31 117 25 3 248 3 zapD Cell division protein ZapD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BII7 1.08e-30 117 25 3 248 3 zapD Cell division protein ZapD Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YST8 1.08e-30 117 25 3 248 3 zapD Cell division protein ZapD Burkholderia ambifaria (strain MC40-6)
B4E5X9 1.28e-30 117 25 3 248 3 zapD Cell division protein ZapD Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BZE9 1.33e-30 117 25 3 248 3 zapD Cell division protein ZapD Burkholderia orbicola (strain AU 1054)
A0K4A1 1.33e-30 117 25 3 248 3 zapD Cell division protein ZapD Burkholderia cenocepacia (strain HI2424)
Q83F03 1.91e-30 117 30 3 254 3 zapD Cell division protein ZapD Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAF8 1.91e-30 117 30 3 254 3 zapD Cell division protein ZapD Coxiella burnetii (strain RSA 331 / Henzerling II)
Q3SGD1 2.44e-30 116 26 3 248 3 zapD Cell division protein ZapD Thiobacillus denitrificans (strain ATCC 25259)
B1JV92 2.92e-30 116 25 3 248 3 zapD Cell division protein ZapD Burkholderia orbicola (strain MC0-3)
Q8XVK1 7.65e-30 115 27 4 249 3 zapD Cell division protein ZapD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2UCW2 1.31e-29 114 26 4 249 3 zapD Cell division protein ZapD Ralstonia pickettii (strain 12J)
Q46X09 2.15e-28 111 26 4 249 3 zapD Cell division protein ZapD Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P60012 2.92e-28 110 30 3 226 3 zapD Cell division protein ZapD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1LIP2 4.45e-28 110 26 4 249 3 zapD Cell division protein ZapD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0K6N8 6.64e-28 110 26 4 249 3 zapD Cell division protein ZapD Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3R8A8 6.86e-28 110 25 4 249 3 zapD Cell division protein ZapD Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10120
Feature type CDS
Gene zapD
Product cell division protein ZapD
Location 2211081 - 2211833 (strand: 1)
Length 753 (nucleotides) / 250 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_914
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07072 Cell division protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4582 Cell cycle control, cell division, chromosome partitioning (D) D Cell division protein ZapD, interacts with FtsZ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18778 cell division protein ZapD - -

Protein Sequence

MSEETSTIIFEHPLNEKMRSWLRIENSLIQLNSFQSINSLSSALSFFRAVSEFIEVLDRGEIRAELLKELEKRQKKLQQWLSFPNVDKEIVSHIINELSESACALSKAPRIGQHLKQDKIISLVKQRLSIPGGCCSFDVPTLHLWLNLPQTVRTEKLTCWQEGLYPLQNALNALLTLIRQSDTFKPVLSHNGFYQDSTEEGELLRIKLLASQQIYPQVSGHKNRYAIRFLPLDSEHGTIPSELPFEISCC

Flanking regions ( +/- flanking 50bp)

CATCAGCATTACTTAGAATTAGCTCAAAAAAGCAATACAGGACAATAGCCATGAGTGAAGAAACCTCAACAATTATTTTTGAACACCCGCTTAATGAGAAAATGCGTTCATGGCTTAGAATTGAAAACTCATTAATTCAATTAAATAGTTTTCAATCTATTAATTCATTATCTTCTGCATTATCTTTTTTTCGTGCCGTTTCAGAATTTATTGAAGTTTTAGATCGCGGGGAGATCCGCGCAGAGCTACTTAAAGAGTTAGAAAAAAGACAAAAAAAACTGCAACAGTGGTTATCCTTTCCTAATGTCGATAAAGAGATTGTCAGTCATATTATTAATGAGTTATCAGAAAGTGCTTGCGCATTAAGTAAAGCACCACGTATTGGACAACATTTAAAACAAGATAAAATCATCAGCTTAGTAAAACAACGCCTCAGTATTCCGGGAGGATGTTGTAGCTTTGACGTCCCTACTTTGCATTTGTGGTTAAATCTTCCTCAAACGGTGCGTACTGAAAAGTTAACTTGTTGGCAGGAAGGGTTATATCCTCTACAAAATGCATTAAATGCCCTATTAACACTTATTCGTCAATCAGATACATTTAAACCGGTATTAAGCCATAATGGTTTTTATCAAGACAGTACGGAAGAAGGTGAATTATTACGGATCAAACTACTTGCCAGCCAGCAAATTTACCCTCAAGTCTCAGGACACAAAAACCGTTATGCTATTCGCTTTTTGCCTCTTGACAGTGAGCATGGCACAATCCCTTCTGAACTACCTTTTGAGATTTCATGTTGTTAATATAGCTTAATATCAACAACAGAAATCATCTCAATTAAATTCAGGAGAGA