Homologs in group_914

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04275 FBDBKF_04275 85.2 Morganella morganii S1 zapD cell division protein ZapD
EHELCC_05565 EHELCC_05565 85.2 Morganella morganii S2 zapD cell division protein ZapD
NLDBIP_05885 NLDBIP_05885 85.2 Morganella morganii S4 zapD cell division protein ZapD
LHKJJB_02765 LHKJJB_02765 85.2 Morganella morganii S3 zapD cell division protein ZapD
HKOGLL_06240 HKOGLL_06240 85.2 Morganella morganii S5 zapD cell division protein ZapD
PMI_RS10120 PMI_RS10120 60.8 Proteus mirabilis HI4320 zapD cell division protein ZapD

Distribution of the homologs in the orthogroup group_914

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_914

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F0Z5 9.21e-116 334 60 0 250 3 zapD Cell division protein ZapD Proteus mirabilis (strain HI4320)
P60013 1.14e-102 301 59 0 250 3 zapD Cell division protein ZapD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G9T9 2.96e-102 300 54 0 250 3 zapD Cell division protein ZapD Serratia proteamaculans (strain 568)
B7LWG7 1.24e-97 288 54 0 243 3 zapD Cell division protein ZapD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A7MIG0 4.18e-97 287 54 0 243 3 zapD Cell division protein ZapD Cronobacter sakazakii (strain ATCC BAA-894)
C6DET1 1.7e-96 285 52 0 250 3 zapD Cell division protein ZapD Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P67693 7.32e-96 283 54 0 243 1 zapD Cell division protein ZapD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67694 7.32e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella typhi
B4TXI8 7.32e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella schwarzengrund (strain CVM19633)
B5BLD5 7.32e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella paratyphi A (strain AKU_12601)
Q5PDD7 7.32e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TJ98 7.32e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella heidelberg (strain SL476)
B5RH77 7.32e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2N7 7.32e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella enteritidis PT4 (strain P125109)
B5FI84 7.32e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella dublin (strain CT_02021853)
A8ALJ5 9.62e-96 283 53 0 243 3 zapD Cell division protein ZapD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4SU61 9.73e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella newport (strain SL254)
Q57TB7 9.73e-96 283 54 0 243 3 zapD Cell division protein ZapD Salmonella choleraesuis (strain SC-B67)
A9MQA5 2.21e-95 282 54 0 243 3 zapD Cell division protein ZapD Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7NHK6 2.82e-94 280 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q6D0J5 3.51e-94 280 51 0 250 3 zapD Cell division protein ZapD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7N7X3 3.58e-94 279 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B2U2A7 4.65e-94 279 53 0 243 3 zapD Cell division protein ZapD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RG94 4.65e-94 279 53 0 243 3 zapD Cell division protein ZapD Escherichia coli (strain UTI89 / UPEC)
B1LG38 4.65e-94 279 53 0 243 3 zapD Cell division protein ZapD Escherichia coli (strain SMS-3-5 / SECEC)
Q8FL56 4.65e-94 279 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLN8 4.65e-94 279 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7E5 4.65e-94 279 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O1:K1 / APEC
B7MNV9 4.65e-94 279 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O81 (strain ED1a)
B7MAM4 4.65e-94 279 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIF1 4.65e-94 279 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q326D3 5.25e-94 279 53 0 243 3 zapD Cell division protein ZapD Shigella boydii serotype 4 (strain Sb227)
Q32JZ0 8.13e-94 278 53 0 243 3 zapD Cell division protein ZapD Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z5Q7 9.26e-94 278 53 0 243 3 zapD Cell division protein ZapD Shigella sonnei (strain Ss046)
B6HZ79 9.26e-94 278 53 0 243 3 zapD Cell division protein ZapD Escherichia coli (strain SE11)
P36680 9.26e-94 278 53 0 243 1 zapD Cell division protein ZapD Escherichia coli (strain K12)
B1IR77 9.26e-94 278 53 0 243 3 zapD Cell division protein ZapD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZW53 9.26e-94 278 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O9:H4 (strain HS)
B1XC78 9.26e-94 278 53 0 243 3 zapD Cell division protein ZapD Escherichia coli (strain K12 / DH10B)
C4ZRJ6 9.26e-94 278 53 0 243 3 zapD Cell division protein ZapD Escherichia coli (strain K12 / MC4100 / BW2952)
B7M143 9.26e-94 278 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O8 (strain IAI1)
B7LFX0 9.26e-94 278 53 0 243 3 zapD Cell division protein ZapD Escherichia coli (strain 55989 / EAEC)
Q83MF4 2.32e-93 277 53 0 243 3 zapD Cell division protein ZapD Shigella flexneri
Q0T896 2.32e-93 277 53 0 243 3 zapD Cell division protein ZapD Shigella flexneri serotype 5b (strain 8401)
B5YZD7 2.34e-93 277 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X988 2.34e-93 277 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O157:H7
A4W6K4 2.76e-93 277 52 0 243 3 zapD Cell division protein ZapD Enterobacter sp. (strain 638)
B2VD53 2.8e-92 275 52 0 244 3 zapD Cell division protein ZapD Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JJK6 1.9e-91 273 53 0 250 3 zapD Cell division protein ZapD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7FM54 9.44e-91 271 52 0 250 3 zapD Cell division protein ZapD Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JK67 1.28e-90 270 52 0 250 3 zapD Cell division protein ZapD Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EJ2 1.28e-90 270 52 0 250 3 zapD Cell division protein ZapD Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPS4 1.28e-90 270 52 0 250 3 zapD Cell division protein ZapD Yersinia pestis (strain Pestoides F)
Q1CLZ0 1.28e-90 270 52 0 250 3 zapD Cell division protein ZapD Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1J6 1.28e-90 270 52 0 250 3 zapD Cell division protein ZapD Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBH9 1.28e-90 270 52 0 250 3 zapD Cell division protein ZapD Yersinia pestis
B2K4G0 1.28e-90 270 52 0 250 3 zapD Cell division protein ZapD Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3S8 1.28e-90 270 52 0 250 3 zapD Cell division protein ZapD Yersinia pestis bv. Antiqua (strain Antiqua)
A6T4P4 1.28e-89 268 55 0 243 3 zapD Cell division protein ZapD Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7ZHJ3 1.45e-89 268 53 0 243 3 zapD Cell division protein ZapD Escherichia coli O139:H28 (strain E24377A / ETEC)
B5F7X6 1.63e-89 268 54 0 243 3 zapD Cell division protein ZapD Salmonella agona (strain SL483)
B5Y1T6 5.48e-89 266 55 0 243 3 zapD Cell division protein ZapD Klebsiella pneumoniae (strain 342)
P67696 7.15e-65 205 41 1 241 3 zapD Cell division protein ZapD Vibrio vulnificus (strain YJ016)
P67695 7.15e-65 205 41 1 241 3 zapD Cell division protein ZapD Vibrio vulnificus (strain CMCP6)
B7VK24 1.08e-60 194 40 2 242 3 zapD Cell division protein ZapD Vibrio atlanticus (strain LGP32)
C3LQX1 5.66e-59 190 38 2 242 3 zapD Cell division protein ZapD Vibrio cholerae serotype O1 (strain M66-2)
Q9KPE2 5.66e-59 190 38 2 242 3 zapD Cell division protein ZapD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5K1 5.66e-59 190 38 2 242 3 zapD Cell division protein ZapD Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87LT3 3.41e-57 185 38 2 242 1 zapD Cell division protein ZapD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LMG6 3.58e-54 177 39 1 245 3 zapD Cell division protein ZapD Photobacterium profundum (strain SS9)
Q5E2R1 1.15e-46 158 36 1 241 3 zapD Cell division protein ZapD Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6ELG5 2.04e-46 157 36 1 241 3 zapD Cell division protein ZapD Aliivibrio salmonicida (strain LFI1238)
Q8EJQ0 3.01e-44 152 34 3 229 3 zapD Cell division protein ZapD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5R0N4 3.78e-43 149 32 3 246 3 zapD Cell division protein ZapD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0HN71 5.09e-40 141 34 2 229 3 zapD Cell division protein ZapD Shewanella sp. (strain MR-4)
Q0HQL6 1.54e-39 140 33 2 229 3 zapD Cell division protein ZapD Shewanella sp. (strain MR-7)
A6WTC8 4.34e-39 139 33 2 229 3 zapD Cell division protein ZapD Shewanella baltica (strain OS185)
Q82WR3 4.37e-39 139 31 3 248 3 zapD Cell division protein ZapD Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B8E665 5.5e-39 138 33 2 229 3 zapD Cell division protein ZapD Shewanella baltica (strain OS223)
Q479P4 1.13e-38 138 33 2 225 3 zapD Cell division protein ZapD Dechloromonas aromatica (strain RCB)
Q0AH80 2.05e-38 137 33 4 248 3 zapD Cell division protein ZapD Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q5P2L5 2.16e-37 135 34 8 258 3 zapD Cell division protein ZapD Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1K3E2 1.77e-36 132 30 5 252 3 zapD Cell division protein ZapD Azoarcus sp. (strain BH72)
A6T2E3 4.83e-36 131 30 3 248 3 zapD Cell division protein ZapD Janthinobacterium sp. (strain Marseille)
Q606C7 6.14e-35 128 30 5 252 3 zapD Cell division protein ZapD Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B2SYW1 2.62e-33 124 29 5 249 3 zapD Cell division protein ZapD Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13U06 3.81e-33 123 29 5 249 3 zapD Cell division protein ZapD Paraburkholderia xenovorans (strain LB400)
Q0BII7 4.1e-33 123 28 3 248 3 zapD Cell division protein ZapD Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YST8 4.1e-33 123 28 3 248 3 zapD Cell division protein ZapD Burkholderia ambifaria (strain MC40-6)
B2JHE6 6.21e-33 123 29 5 249 3 zapD Cell division protein ZapD Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1BZE9 9.2e-33 122 27 3 248 3 zapD Cell division protein ZapD Burkholderia orbicola (strain AU 1054)
A0K4A1 9.2e-33 122 27 3 248 3 zapD Cell division protein ZapD Burkholderia cenocepacia (strain HI2424)
B1JV92 1.09e-32 122 27 3 248 3 zapD Cell division protein ZapD Burkholderia orbicola (strain MC0-3)
Q39JV6 1.09e-32 122 27 3 248 3 zapD Cell division protein ZapD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A4JBA8 2.87e-32 121 27 3 248 3 zapD Cell division protein ZapD Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9AI82 2.96e-32 121 27 3 248 3 zapD Cell division protein ZapD Burkholderia multivorans (strain ATCC 17616 / 249)
Q63QL1 6.22e-32 120 27 3 248 3 zapD Cell division protein ZapD Burkholderia pseudomallei (strain K96243)
A3NDU9 6.22e-32 120 27 3 248 3 zapD Cell division protein ZapD Burkholderia pseudomallei (strain 668)
Q3JNF2 6.22e-32 120 27 3 248 3 zapD Cell division protein ZapD Burkholderia pseudomallei (strain 1710b)
A3NZK0 6.22e-32 120 27 3 248 3 zapD Cell division protein ZapD Burkholderia pseudomallei (strain 1106a)
A1V0Q3 6.22e-32 120 27 3 248 3 zapD Cell division protein ZapD Burkholderia mallei (strain SAVP1)
Q62GU2 6.22e-32 120 27 3 248 3 zapD Cell division protein ZapD Burkholderia mallei (strain ATCC 23344)
A2S5S9 6.22e-32 120 27 3 248 3 zapD Cell division protein ZapD Burkholderia mallei (strain NCTC 10229)
A3MR78 6.22e-32 120 27 3 248 3 zapD Cell division protein ZapD Burkholderia mallei (strain NCTC 10247)
Q2SZG9 7.45e-32 120 27 3 248 3 zapD Cell division protein ZapD Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B4E5X9 2e-31 119 27 3 248 3 zapD Cell division protein ZapD Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
P67690 5.58e-30 115 28 4 248 3 zapD Cell division protein ZapD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P67692 5.58e-30 115 28 4 248 3 zapD Cell division protein ZapD Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P67691 5.58e-30 115 28 4 248 3 zapD Cell division protein ZapD Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9I1I9 2.54e-28 111 24 2 247 3 zapD Cell division protein ZapD Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q3SGD1 2.98e-28 110 28 3 246 3 zapD Cell division protein ZapD Thiobacillus denitrificans (strain ATCC 25259)
P60012 6.64e-28 110 29 2 226 3 zapD Cell division protein ZapD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1LIP2 6.73e-27 107 28 5 253 3 zapD Cell division protein ZapD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8XVK1 2.48e-26 105 28 6 253 3 zapD Cell division protein ZapD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q83F03 3.54e-26 105 28 3 252 3 zapD Cell division protein ZapD Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAF8 3.54e-26 105 28 3 252 3 zapD Cell division protein ZapD Coxiella burnetii (strain RSA 331 / Henzerling II)
B2UCW2 4.32e-26 105 27 5 253 3 zapD Cell division protein ZapD Ralstonia pickettii (strain 12J)
Q46X09 1.95e-24 100 26 5 253 3 zapD Cell division protein ZapD Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K6N8 7.19e-24 99 25 3 249 3 zapD Cell division protein ZapD Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3R8A8 1.69e-23 98 25 3 249 3 zapD Cell division protein ZapD Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08720
Feature type CDS
Gene zapD
Product cell division protein ZapD
Location 1804479 - 1805231 (strand: 1)
Length 753 (nucleotides) / 250 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_914
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07072 Cell division protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4582 Cell cycle control, cell division, chromosome partitioning (D) D Cell division protein ZapD, interacts with FtsZ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18778 cell division protein ZapD - -

Protein Sequence

MNETCQSVIFEHPLNERTRSWLRIETSLQQMHTLTPLDSLPASLAFFRAAAEFIEVTDRGEVRSEILKELEKQQKKLMKWAEAPNADPALIQGLSDDLKQQSAALSNAPRIAQHLKDDKIIAIVRQRLSIPGGCCGFDLPYLHLWLNLSQDVRDTTLSGWLEGLQPLKNALGSLLTLLRQSARFNAVESHNGFYQDNAEGADLLRLRIPVDYRIYPQVSGHKSRFAIRFLHMDSEHGIIPTQLPFEIACC

Flanking regions ( +/- flanking 50bp)

TTACATGAACAATATTTAGCTTTGGCCCGTCAGCCAAAATAGGGATCACTATGAATGAAACTTGTCAGTCAGTCATTTTTGAACATCCGTTAAACGAACGAACCCGTTCATGGCTGCGTATCGAAACGTCACTGCAACAGATGCATACACTGACACCACTGGATTCGCTCCCCGCCAGCCTCGCCTTTTTTCGCGCTGCCGCTGAATTTATTGAAGTGACCGATCGCGGGGAAGTCCGCTCCGAAATATTAAAAGAACTGGAAAAACAGCAGAAGAAACTCATGAAGTGGGCCGAAGCACCTAATGCTGATCCGGCGCTTATTCAGGGTTTATCTGATGATTTAAAACAACAGTCCGCTGCACTGAGCAACGCCCCCCGCATAGCACAACACCTGAAAGACGATAAAATTATTGCTATCGTCCGCCAGCGGCTGAGTATCCCGGGTGGCTGCTGTGGTTTTGATTTACCCTACCTTCATTTGTGGCTTAATTTATCACAGGATGTGCGGGACACCACTCTCAGCGGCTGGCTGGAAGGCTTACAGCCACTGAAGAACGCACTCGGCAGCCTGTTGACACTGCTGCGCCAGTCCGCCCGTTTCAATGCGGTCGAAAGTCATAACGGGTTTTATCAGGATAATGCGGAAGGTGCGGATTTACTGCGCCTGCGTATTCCGGTGGACTACCGGATCTACCCTCAGGTTTCAGGACATAAATCGCGATTTGCAATACGTTTTCTGCATATGGACAGCGAACACGGTATAATACCAACTCAGTTACCGTTTGAAATCGCCTGTTGTTAAAAGGAAATCCTTTATGTCTGAAGCCATCATTGTCAATTGCCCCACCTGTA