Homologs in group_828

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04160 FBDBKF_04160 57.0 Morganella morganii S1 ygfB UPF0149 protein
EHELCC_05450 EHELCC_05450 57.0 Morganella morganii S2 ygfB UPF0149 protein
NLDBIP_05770 NLDBIP_05770 57.0 Morganella morganii S4 ygfB UPF0149 protein
LHKJJB_02650 LHKJJB_02650 57.0 Morganella morganii S3 ygfB UPF0149 protein
HKOGLL_06125 HKOGLL_06125 57.0 Morganella morganii S5 ygfB UPF0149 protein
F4V73_RS08605 F4V73_RS08605 57.0 Morganella psychrotolerans - YecA family protein

Distribution of the homologs in the orthogroup group_828

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_828

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N193 4.86e-80 239 60 1 187 3 plu3602 UPF0149 protein plu3602 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8ZHI2 1.45e-70 215 56 2 188 3 YPO0911 UPF0149 protein YPO0911/y3298/YP_3608 Yersinia pestis
B1JNS1 1.45e-70 215 56 2 188 3 YPK_0862 UPF0149 protein YPK_0862 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FF15 1.45e-70 215 56 2 188 3 YpsIP31758_0859 UPF0149 protein YpsIP31758_0859 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TIA1 1.45e-70 215 56 2 188 3 YPDSF_0603 UPF0149 protein YPDSF_0603 Yersinia pestis (strain Pestoides F)
A9R4K2 1.45e-70 215 56 2 188 3 YpAngola_A3826 UPF0149 protein YpAngola_A3826 Yersinia pestis bv. Antiqua (strain Angola)
Q1CB48 1.45e-70 215 56 2 188 3 YPA_0356 UPF0149 protein YPA_0356 Yersinia pestis bv. Antiqua (strain Antiqua)
B2K0R0 1.45e-70 215 56 2 188 3 YPTS_3318 UPF0149 protein YPTS_3318 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q666R1 1.45e-70 215 56 2 188 3 YPTB3186 UPF0149 protein YPTB3186 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CEZ3 1.45e-70 215 56 2 188 3 YPN_3110 UPF0149 protein YPN_3110 Yersinia pestis bv. Antiqua (strain Nepal516)
A1JPP0 3.74e-68 209 54 2 188 3 YE3397 UPF0149 protein YE3397 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GIS5 3.65e-65 201 56 2 188 3 Spro_3920 UPF0149 protein Spro_3920 Serratia proteamaculans (strain 568)
Q8ZM71 1.76e-64 200 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TV29 1.76e-64 200 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella schwarzengrund (strain CVM19633)
C0PY33 1.76e-64 200 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella paratyphi C (strain RKS4594)
B4T555 1.76e-64 200 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella newport (strain SL254)
B4THE2 1.76e-64 200 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella heidelberg (strain SL476)
B5RE20 1.76e-64 200 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXI6 1.76e-64 200 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella enteritidis PT4 (strain P125109)
B5FUH3 1.76e-64 200 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella dublin (strain CT_02021853)
B5F5I5 1.76e-64 200 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella agona (strain SL483)
Q8Z3W5 2.57e-64 199 54 2 188 3 ygfB UPF0149 protein YgfB Salmonella typhi
B5XUC9 2.58e-59 187 55 2 188 3 KPK_0755 UPF0149 protein KPK_0755 Klebsiella pneumoniae (strain 342)
A6TDS1 4.75e-59 186 55 2 188 3 KPN78578_32810 UPF0149 protein KPN78578_32810 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P0A8C7 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Shigella flexneri
B2U0S6 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LPC3 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I742 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli (strain SE11)
B7N7F2 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8C4 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli (strain K12)
P0A8C5 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A450 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O9:H4 (strain HS)
B1XEJ5 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli (strain K12 / DH10B)
C5A0I1 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYH3 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O8 (strain IAI1)
B7MZK6 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O81 (strain ED1a)
B7NHX0 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQA3 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8C6 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O157:H7
B7LFG8 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli (strain 55989 / EAEC)
B7MM95 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHV7 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZR19 3.93e-57 181 54 2 188 3 ygfB UPF0149 protein YgfB Escherichia coli O139:H28 (strain E24377A / ETEC)
C5BAT6 1.36e-55 177 52 2 188 3 NT01EI_3357 UPF0149 protein NT01EI_3357 Edwardsiella ictaluri (strain 93-146)
B2VF41 9.74e-54 172 56 3 176 3 ETA_28040 UPF0149 protein ETA_28040 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q9CKA2 1.65e-45 151 43 2 170 3 PM1723 UPF0149 protein PM1723 Pasteurella multocida (strain Pm70)
A5UHW8 4.41e-34 122 41 3 170 3 CGSHiGG_07585 UPF0149 protein CGSHiGG_07585 Haemophilus influenzae (strain PittGG)
Q4QM83 1.96e-33 120 41 3 170 3 NTHI0981 UPF0149 protein NTHI0981 Haemophilus influenzae (strain 86-028NP)
A5UDQ7 1.96e-33 120 41 3 170 3 CGSHiEE_07975 UPF0149 protein CGSHiEE_07975 Haemophilus influenzae (strain PittEE)
Q7MHM2 2.29e-33 120 36 4 187 3 VV2847 UPF0149 protein VV2847 Vibrio vulnificus (strain YJ016)
P44882 7.14e-33 119 40 3 170 1 HI_0817 UPF0149 protein HI_0817 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DC90 8.93e-33 119 35 4 187 3 VV1_1551 UPF0149 protein VV1_1551 Vibrio vulnificus (strain CMCP6)
Q87LM3 1.85e-31 115 35 3 181 3 VP2588 UPF0149 protein VP2588 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VK95 2.57e-31 115 35 3 178 3 VS_2635 UPF0149 protein VS_2635 Vibrio atlanticus (strain LGP32)
A7MZA1 1.85e-30 113 35 3 180 3 VIBHAR_03551 UPF0149 protein VIBHAR_03551 Vibrio campbellii (strain ATCC BAA-1116)
B6EKP3 8.98e-30 111 38 2 164 3 VSAL_I2539 UPF0149 protein VSAL_I2539 Aliivibrio salmonicida (strain LFI1238)
A5F5F7 5.09e-28 107 32 4 196 3 VC0395_A2053 UPF0149 protein VC0395_A2053/VC395_2591 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LR19 5.09e-28 107 32 4 196 3 VCM66_2399 UPF0149 protein VCM66_2399 Vibrio cholerae serotype O1 (strain M66-2)
Q9KP97 7.09e-28 106 32 4 196 3 VC_2476 UPF0149 protein VC_2476 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B5FAI5 7.94e-27 103 33 2 164 3 VFMJ11_2207 UPF0149 protein VFMJ11_2207 Aliivibrio fischeri (strain MJ11)
Q5E2Z9 1.05e-26 103 32 2 164 3 VF_2102 UPF0149 protein VF_2102 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0U772 2.38e-19 84 33 6 180 3 Xfasm12_0965 UPF0149 protein Xfasm12_0965 Xylella fastidiosa (strain M12)
B2IAK4 4.78e-19 83 33 6 180 3 XfasM23_0847 UPF0149 protein XfasM23_0847 Xylella fastidiosa (strain M23)
Q87D84 4.78e-19 83 33 6 180 3 PD_0802 UPF0149 protein PD_0802 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8PH54 1.1e-16 77 33 5 169 3 XAC3406 UPF0149 protein XAC3406 Xanthomonas axonopodis pv. citri (strain 306)
Q2P6P4 6.08e-16 75 34 5 167 3 XOO1028 UPF0149 protein XOO1028 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BPQ9 1.1e-15 74 34 5 169 3 XCV3523 UPF0149 protein XCV3523 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q4UY95 1.31e-15 74 31 5 169 3 XC_0904 UPF0149 protein XC_0904 Xanthomonas campestris pv. campestris (strain 8004)
Q8P5S6 1.31e-15 74 31 5 169 3 XCC3260 UPF0149 protein XCC3260 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9HTW5 1.73e-15 73 33 6 174 3 PA5225 UPF0149 protein PA5225 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02ED9 1.73e-15 73 33 6 174 3 PA14_69010 UPF0149 protein PA14_69010 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V5B5 1.73e-15 73 33 6 174 3 PLES_56191 UPF0149 protein PLES_56191 Pseudomonas aeruginosa (strain LESB58)
A6VDZ9 8.45e-15 72 33 6 174 3 PSPA7_5968 UPF0149 protein PSPA7_5968 Pseudomonas aeruginosa (strain PA7)
Q48PR0 3.68e-11 62 30 6 179 3 PSPPH_0305 UPF0149 protein PSPPH_0305 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87US2 6.35e-10 59 30 6 179 3 PSPTO_5224 UPF0149 protein PSPTO_5224 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9PBX5 8.15e-10 58 34 6 179 3 XF_2010 UPF0149 protein XF_2010 Xylella fastidiosa (strain 9a5c)
C1DJ20 1.1e-09 58 29 4 164 3 Avin_47340 UPF0149 protein Avin_47340 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B1JEZ1 1.14e-08 55 28 5 173 3 PputW619_5026 UPF0149 protein PputW619_5026 Pseudomonas putida (strain W619)
Q4K406 1.28e-08 55 31 8 175 3 PFL_5969 UPF0149 protein PFL_5969 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q88CI0 3.11e-08 54 27 1 169 3 PP_5201 UPF0149 protein PP_5201 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WAR6 3.11e-08 54 27 1 169 3 Pput_5108 UPF0149 protein Pput_5108 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3K4Y2 2.61e-07 52 29 6 175 3 Pfl01_5435 UPF0149 protein Pfl01_5435 Pseudomonas fluorescens (strain Pf0-1)
B0KP86 4.14e-07 51 27 4 175 3 PputGB1_5261 UPF0149 protein PputGB1_5261 Pseudomonas putida (strain GB-1)
A4XP32 5.26e-07 51 28 1 148 3 Pmen_0324 UPF0149 protein Pmen_0324 Pseudomonas mendocina (strain ymp)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09985
Feature type CDS
Gene -
Product YecA family protein
Location 2165793 - 2166377 (strand: -1)
Length 585 (nucleotides) / 194 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_828
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03695 Uncharacterised protein family (UPF0149)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3079 Function unknown (S) S Uncharacterized conserved protein YgfB, UPF0149 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09895 uncharacterized protein - -

Protein Sequence

MSIQNTLPDYSAIDSLLQQHAVPLTAAEMHGLITGFICGAVHDNSWKTLLHELTNEGLAFPKSLSEPLESLYHVTHEQLDDSVFNFSMLLPDDTESVFPRADALAGWVNHFLLGLGVAQPKLSEHKELTEVITDLRNIGALGYEEDENQQELEDALEEVTEYVKVSVQLCYITFVASKETTTENDKQDEQRTLH

Flanking regions ( +/- flanking 50bp)

TTGATGGTAGCATATCTTGAACTATTCCCCTAAATGCGACGTTTATTCTTATGTCAATACAAAACACATTACCAGATTACTCAGCAATTGATTCATTATTACAACAACATGCCGTGCCTTTAACTGCCGCAGAGATGCATGGCCTAATTACTGGGTTTATTTGTGGAGCAGTACATGACAATAGTTGGAAAACTTTGTTACATGAACTGACTAATGAGGGCTTAGCGTTCCCTAAATCGTTATCAGAACCCCTTGAATCACTTTATCACGTCACTCATGAGCAACTTGATGACAGCGTATTTAATTTTTCTATGCTGTTACCTGACGATACAGAATCTGTTTTTCCTCGAGCTGATGCCCTTGCAGGGTGGGTTAATCATTTTCTATTAGGATTAGGTGTTGCACAACCTAAGTTATCTGAGCATAAAGAGTTGACGGAAGTTATCACTGATTTGCGTAATATTGGTGCATTAGGCTATGAAGAAGATGAAAATCAACAAGAGCTTGAAGATGCACTCGAAGAAGTTACAGAATATGTCAAAGTCTCTGTTCAGCTGTGCTATATCACTTTTGTCGCCTCAAAAGAGACAACAACAGAAAATGATAAACAAGATGAACAACGGACATTACATTAATAATTGCCTTATTAATTAGATAACCAAAAGATCAATAAAGGATAGGAGTG