Homologs in group_828

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_05450 EHELCC_05450 100.0 Morganella morganii S2 ygfB UPF0149 protein
NLDBIP_05770 NLDBIP_05770 100.0 Morganella morganii S4 ygfB UPF0149 protein
LHKJJB_02650 LHKJJB_02650 100.0 Morganella morganii S3 ygfB UPF0149 protein
HKOGLL_06125 HKOGLL_06125 100.0 Morganella morganii S5 ygfB UPF0149 protein
F4V73_RS08605 F4V73_RS08605 92.2 Morganella psychrotolerans - YecA family protein
PMI_RS09985 PMI_RS09985 57.0 Proteus mirabilis HI4320 - YecA family protein

Distribution of the homologs in the orthogroup group_828

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_828

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N193 1.11e-85 253 62 1 193 3 plu3602 UPF0149 protein plu3602 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JPP0 3.85e-68 209 56 4 196 3 YE3397 UPF0149 protein YE3397 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZHI2 8.68e-66 203 55 4 196 3 YPO0911 UPF0149 protein YPO0911/y3298/YP_3608 Yersinia pestis
B1JNS1 8.68e-66 203 55 4 196 3 YPK_0862 UPF0149 protein YPK_0862 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FF15 8.68e-66 203 55 4 196 3 YpsIP31758_0859 UPF0149 protein YpsIP31758_0859 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TIA1 8.68e-66 203 55 4 196 3 YPDSF_0603 UPF0149 protein YPDSF_0603 Yersinia pestis (strain Pestoides F)
A9R4K2 8.68e-66 203 55 4 196 3 YpAngola_A3826 UPF0149 protein YpAngola_A3826 Yersinia pestis bv. Antiqua (strain Angola)
Q1CB48 8.68e-66 203 55 4 196 3 YPA_0356 UPF0149 protein YPA_0356 Yersinia pestis bv. Antiqua (strain Antiqua)
B2K0R0 8.68e-66 203 55 4 196 3 YPTS_3318 UPF0149 protein YPTS_3318 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q666R1 8.68e-66 203 55 4 196 3 YPTB3186 UPF0149 protein YPTB3186 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CEZ3 8.68e-66 203 55 4 196 3 YPN_3110 UPF0149 protein YPN_3110 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZM71 1.08e-62 195 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TV29 1.08e-62 195 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella schwarzengrund (strain CVM19633)
C0PY33 1.08e-62 195 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella paratyphi C (strain RKS4594)
B4T555 1.08e-62 195 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella newport (strain SL254)
B4THE2 1.08e-62 195 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella heidelberg (strain SL476)
B5RE20 1.08e-62 195 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXI6 1.08e-62 195 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella enteritidis PT4 (strain P125109)
B5FUH3 1.08e-62 195 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella dublin (strain CT_02021853)
B5F5I5 1.08e-62 195 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella agona (strain SL483)
Q8Z3W5 2.06e-62 194 51 4 196 3 ygfB UPF0149 protein YgfB Salmonella typhi
B5XUC9 9.21e-61 190 55 4 196 3 KPK_0755 UPF0149 protein KPK_0755 Klebsiella pneumoniae (strain 342)
A6TDS1 2.71e-59 186 55 4 196 3 KPN78578_32810 UPF0149 protein KPN78578_32810 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8GIS5 4.38e-59 186 53 4 196 3 Spro_3920 UPF0149 protein Spro_3920 Serratia proteamaculans (strain 568)
P0A8C7 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Shigella flexneri
B2U0S6 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LPC3 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I742 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli (strain SE11)
B7N7F2 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8C4 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli (strain K12)
P0A8C5 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A450 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O9:H4 (strain HS)
B1XEJ5 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli (strain K12 / DH10B)
C5A0I1 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYH3 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O8 (strain IAI1)
B7MZK6 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O81 (strain ED1a)
B7NHX0 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQA3 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8C6 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O157:H7
B7LFG8 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli (strain 55989 / EAEC)
B7MM95 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHV7 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZR19 7.08e-59 186 53 4 196 3 ygfB UPF0149 protein YgfB Escherichia coli O139:H28 (strain E24377A / ETEC)
C5BAT6 1.11e-56 180 59 2 173 3 NT01EI_3357 UPF0149 protein NT01EI_3357 Edwardsiella ictaluri (strain 93-146)
B2VF41 4.13e-53 171 53 4 195 3 ETA_28040 UPF0149 protein ETA_28040 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q9CKA2 3.17e-43 145 41 3 189 3 PM1723 UPF0149 protein PM1723 Pasteurella multocida (strain Pm70)
Q8DC90 4.86e-35 125 36 4 192 3 VV1_1551 UPF0149 protein VV1_1551 Vibrio vulnificus (strain CMCP6)
Q7MHM2 6.63e-34 122 35 4 192 3 VV2847 UPF0149 protein VV2847 Vibrio vulnificus (strain YJ016)
A5UHW8 7.9e-34 121 43 4 183 3 CGSHiGG_07585 UPF0149 protein CGSHiGG_07585 Haemophilus influenzae (strain PittGG)
Q4QM83 9.99e-33 118 42 4 183 3 NTHI0981 UPF0149 protein NTHI0981 Haemophilus influenzae (strain 86-028NP)
A5UDQ7 9.99e-33 118 42 4 183 3 CGSHiEE_07975 UPF0149 protein CGSHiEE_07975 Haemophilus influenzae (strain PittEE)
A7MZA1 1.99e-32 118 37 5 194 3 VIBHAR_03551 UPF0149 protein VIBHAR_03551 Vibrio campbellii (strain ATCC BAA-1116)
Q87LM3 3.61e-32 117 36 5 194 3 VP2588 UPF0149 protein VP2588 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P44882 7.35e-32 116 42 4 183 1 HI_0817 UPF0149 protein HI_0817 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B6EKP3 3.31e-30 112 37 3 182 3 VSAL_I2539 UPF0149 protein VSAL_I2539 Aliivibrio salmonicida (strain LFI1238)
B7VK95 2.05e-29 110 34 5 195 3 VS_2635 UPF0149 protein VS_2635 Vibrio atlanticus (strain LGP32)
A5F5F7 3.21e-28 107 36 7 195 3 VC0395_A2053 UPF0149 protein VC0395_A2053/VC395_2591 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LR19 3.21e-28 107 36 7 195 3 VCM66_2399 UPF0149 protein VCM66_2399 Vibrio cholerae serotype O1 (strain M66-2)
Q9KP97 4.67e-28 107 36 7 195 3 VC_2476 UPF0149 protein VC_2476 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B5FAI5 5.16e-28 107 35 2 173 3 VFMJ11_2207 UPF0149 protein VFMJ11_2207 Aliivibrio fischeri (strain MJ11)
Q5E2Z9 8.37e-28 106 35 2 173 3 VF_2102 UPF0149 protein VF_2102 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0U772 3.16e-20 86 37 7 185 3 Xfasm12_0965 UPF0149 protein Xfasm12_0965 Xylella fastidiosa (strain M12)
B2IAK4 1.4e-18 82 35 6 185 3 XfasM23_0847 UPF0149 protein XfasM23_0847 Xylella fastidiosa (strain M23)
Q87D84 1.4e-18 82 35 6 185 3 PD_0802 UPF0149 protein PD_0802 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q4UY95 5.13e-17 78 35 5 181 3 XC_0904 UPF0149 protein XC_0904 Xanthomonas campestris pv. campestris (strain 8004)
Q8P5S6 5.13e-17 78 35 5 181 3 XCC3260 UPF0149 protein XCC3260 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A6VDZ9 1.74e-15 73 29 4 186 3 PSPA7_5968 UPF0149 protein PSPA7_5968 Pseudomonas aeruginosa (strain PA7)
C1DJ20 1.78e-15 73 32 5 195 3 Avin_47340 UPF0149 protein Avin_47340 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9HTW5 2.14e-15 73 29 4 186 3 PA5225 UPF0149 protein PA5225 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02ED9 2.14e-15 73 29 4 186 3 PA14_69010 UPF0149 protein PA14_69010 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V5B5 2.14e-15 73 29 4 186 3 PLES_56191 UPF0149 protein PLES_56191 Pseudomonas aeruginosa (strain LESB58)
Q8PH54 1.81e-14 71 36 6 181 3 XAC3406 UPF0149 protein XAC3406 Xanthomonas axonopodis pv. citri (strain 306)
Q3BPQ9 4.83e-14 70 36 6 181 3 XCV3523 UPF0149 protein XCV3523 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q2P6P4 7.42e-13 67 35 6 181 3 XOO1028 UPF0149 protein XOO1028 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q48PR0 3.6e-11 62 30 6 188 3 PSPPH_0305 UPF0149 protein PSPPH_0305 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87US2 4.02e-10 59 27 5 190 3 PSPTO_5224 UPF0149 protein PSPTO_5224 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4K406 2.3e-09 57 29 6 187 3 PFL_5969 UPF0149 protein PFL_5969 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K4Y2 1.02e-08 55 27 7 195 3 Pfl01_5435 UPF0149 protein Pfl01_5435 Pseudomonas fluorescens (strain Pf0-1)
B1JEZ1 1.59e-08 55 30 8 196 3 PputW619_5026 UPF0149 protein PputW619_5026 Pseudomonas putida (strain W619)
Q9PBX5 3.87e-08 54 36 6 183 3 XF_2010 UPF0149 protein XF_2010 Xylella fastidiosa (strain 9a5c)
A4XP32 5.37e-08 53 32 5 153 3 Pmen_0324 UPF0149 protein Pmen_0324 Pseudomonas mendocina (strain ymp)
Q1I350 2.09e-07 52 31 4 180 3 PSEEN5316 UPF0149 protein PSEEN5316 Pseudomonas entomophila (strain L48)
B0KP86 7.78e-06 47 28 5 168 3 PputGB1_5261 UPF0149 protein PputGB1_5261 Pseudomonas putida (strain GB-1)
Q88CI0 1.81e-05 46 28 4 174 3 PP_5201 UPF0149 protein PP_5201 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WAR6 1.81e-05 46 28 4 174 3 Pput_5108 UPF0149 protein Pput_5108 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_04160
Feature type CDS
Gene ygfB
Product UPF0149 protein
Location 18868 - 19449 (strand: -1)
Length 582 (nucleotides) / 193 (amino acids)

Contig

Accession contig_4
Length 199551 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_828
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03695 Uncharacterised protein family (UPF0149)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3079 Function unknown (S) S Uncharacterized conserved protein YgfB, UPF0149 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09895 uncharacterized protein - -

Protein Sequence

MTPDKTLPDFKTLDELLRQQAVAMTASEMHGLITGLLCGGNTDDSWLALIHDLTNEGMAFSQVLAQPLRALFNTTFELLDDTECQFNLLLPDDEAGVFARADELAGWVNHFLLGLGVADPKFSDRKEVKEIVTDLREIGMLGYDEAEDAEELDDALEEVIEYVRVAVQLCYISLAKPRSAQKADAPEQKPTLH

Flanking regions ( +/- flanking 50bp)

CTCTTGATGGTAGCATATCATGAACTGAAACCCGACTGGTGAGCAAAATAATGACCCCGGATAAAACACTGCCCGATTTTAAAACACTTGATGAACTTTTGCGTCAGCAGGCCGTCGCCATGACCGCGTCAGAGATGCACGGCCTGATCACGGGTCTGCTCTGCGGCGGTAACACAGATGACAGCTGGCTGGCACTGATCCACGACCTGACCAACGAAGGCATGGCGTTTTCACAGGTTCTGGCACAGCCGCTGCGTGCTCTCTTTAATACCACATTTGAACTGCTTGATGATACCGAATGTCAGTTTAATTTACTGCTGCCGGATGATGAAGCGGGTGTGTTTGCCCGGGCTGATGAGCTGGCCGGCTGGGTCAATCACTTCTTATTAGGTCTGGGTGTGGCGGATCCGAAATTCAGTGATCGCAAGGAAGTAAAAGAAATTGTGACTGATCTGCGGGAAATCGGCATGCTGGGCTATGATGAGGCAGAAGATGCCGAAGAGTTGGATGACGCGCTGGAAGAGGTGATCGAGTATGTCCGCGTGGCGGTACAGCTGTGCTATATCTCGCTGGCGAAGCCGCGCAGCGCACAAAAGGCTGATGCGCCGGAACAGAAACCGACATTACACTGATATATCTGAATCTGTCCGCAGCAGATAATCTGCGGCACACTGAACCATCA