Homologs in group_511

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01055 FBDBKF_01055 93.0 Morganella morganii S1 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
EHELCC_00490 EHELCC_00490 93.0 Morganella morganii S2 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
NLDBIP_02970 NLDBIP_02970 93.0 Morganella morganii S4 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
LHKJJB_04485 LHKJJB_04485 93.0 Morganella morganii S3 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
HKOGLL_02560 HKOGLL_02560 93.0 Morganella morganii S5 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
F4V73_RS07130 F4V73_RS07130 91.7 Morganella psychrotolerans ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase

Distribution of the homologs in the orthogroup group_511

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_511

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EZT3 0.0 752 100 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Proteus mirabilis (strain HI4320)
A8GHW5 0.0 687 90 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Serratia proteamaculans (strain 568)
Q7N706 0.0 686 89 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P72241 0.0 680 92 0 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Providencia stuartii
C6DBH4 0.0 677 88 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D276 0.0 676 88 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JS05 0.0 674 88 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667Z9 0.0 674 88 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CK91 0.0 674 88 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis bv. Antiqua (strain Nepal516)
A9R802 0.0 674 88 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis bv. Antiqua (strain Angola)
P58672 0.0 674 88 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis
B2K9Q0 0.0 674 88 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5I8 0.0 674 88 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFY9 0.0 674 88 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TMT7 0.0 674 88 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis (strain Pestoides F)
A1JKS2 0.0 673 88 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MGV7 0.0 669 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Cronobacter sakazakii (strain ATCC BAA-894)
B7LKC3 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R8L8 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain UTI89 / UPEC)
B6I587 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain SE11)
P62620 0.0 668 87 1 373 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain K12)
B1IWE6 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P62621 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEX0 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AE53 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O1:K1 / APEC
B1XAZ0 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain K12 / DH10B)
C4ZX90 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain K12 / MC4100 / BW2952)
B7MYF0 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O81 (strain ED1a)
B7NRG5 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0Y4 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62622 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O157:H7
B7LDA7 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain 55989 / EAEC)
B7MI00 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGW1 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPV8 0.0 668 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O139:H28 (strain E24377A / ETEC)
B5FAX2 0.0 667 87 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aliivibrio fischeri (strain MJ11)
B1LNH0 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain SMS-3-5 / SECEC)
Q3YZ37 0.0 666 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella sonnei (strain Ss046)
Q32D47 0.0 666 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella dysenteriae serotype 1 (strain Sd197)
Q31XX5 0.0 666 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella boydii serotype 4 (strain Sb227)
B7N6A3 0.0 666 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A8A321 0.0 666 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O9:H4 (strain HS)
Q87S16 0.0 665 87 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7M7L9 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O8 (strain IAI1)
Q83K43 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella flexneri
Q0T204 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella flexneri serotype 5b (strain 8401)
Q5E772 0.0 665 86 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aliivibrio fischeri (strain ATCC 700601 / ES114)
B2VE89 0.0 664 86 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6LU49 0.0 664 86 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Photobacterium profundum (strain SS9)
A6TCD4 0.0 664 87 1 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5RCZ2 0.0 663 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5XNL5 0.0 662 87 1 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Klebsiella pneumoniae (strain 342)
Q7MNF1 0.0 661 87 0 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio vulnificus (strain YJ016)
Q8DEZ8 0.0 661 87 0 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio vulnificus (strain CMCP6)
B2TXU0 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P58671 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BAY5 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella paratyphi A (strain AKU_12601)
Q5PNI2 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0P9 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella newport (strain SL254)
B4TD93 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella heidelberg (strain SL476)
B5R582 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella enteritidis PT4 (strain P125109)
B5FR63 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella dublin (strain CT_02021853)
Q57LI6 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella choleraesuis (strain SC-B67)
B5F198 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella agona (strain SL483)
A7MU42 0.0 660 86 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio campbellii (strain ATCC BAA-1116)
A8AD71 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4TR95 0.0 659 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella schwarzengrund (strain CVM19633)
P58670 0.0 659 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella typhi
A9N201 0.0 658 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A9MHL5 0.0 658 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9KTX1 0.0 657 86 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A4WD93 0.0 657 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Enterobacter sp. (strain 638)
B6EGY7 0.0 657 85 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aliivibrio salmonicida (strain LFI1238)
Q2NS40 0.0 654 86 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sodalis glossinidius (strain morsitans)
B7VJT8 0.0 652 85 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio atlanticus (strain LGP32)
A8H245 0.0 646 84 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLI4 0.0 645 86 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella halifaxensis (strain HAW-EB4)
B8CKR1 0.0 639 85 0 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella piezotolerans (strain WP3 / JCM 13877)
A3QCG2 0.0 639 84 0 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S863 0.0 633 85 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A1RHQ3 0.0 630 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sp. (strain W3-18-1)
A4Y8U0 0.0 630 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EC32 0.0 630 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KXK8 0.0 630 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella baltica (strain OS195)
A6WQP7 0.0 630 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella baltica (strain OS185)
A3D6V9 0.0 630 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E9S7 0.0 630 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella baltica (strain OS223)
Q0HX57 0.0 629 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sp. (strain MR-7)
Q0HKV9 0.0 629 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sp. (strain MR-4)
A0KUJ5 0.0 629 82 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sp. (strain ANA-3)
Q7VME2 0.0 629 83 1 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A8FT70 0.0 629 82 0 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sediminis (strain HAW-EB3)
Q085U6 0.0 628 83 0 367 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella frigidimarina (strain NCIMB 400)
Q12PT4 0.0 627 81 0 367 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B4RV89 0.0 627 83 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B1KKJ2 0.0 624 80 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella woodyi (strain ATCC 51908 / MS32)
P57987 0.0 624 84 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pasteurella multocida (strain Pm70)
P44667 0.0 623 84 1 367 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6VQX6 0.0 623 83 0 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A5UGH1 0.0 622 83 1 367 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus influenzae (strain PittGG)
B0BQB9 0.0 622 83 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GY64 0.0 622 83 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1H8 0.0 622 83 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q4QNH4 0.0 621 83 1 367 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus influenzae (strain 86-028NP)
B0USG8 0.0 619 82 1 367 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Histophilus somni (strain 2336)
Q0I2E9 0.0 619 82 1 367 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Histophilus somni (strain 129Pt)
Q65R84 0.0 617 82 1 367 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C4K4I8 0.0 613 81 1 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q47WC0 0.0 599 80 0 357 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q1LU77 0.0 594 78 0 365 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Baumannia cicadellinicola subsp. Homalodisca coagulata
A1SU39 0.0 584 78 0 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q5QYA9 0.0 584 76 1 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A5UAB9 0.0 580 86 1 328 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus influenzae (strain PittEE)
Q3ICZ5 0.0 578 78 0 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudoalteromonas translucida (strain TAC 125)
Q492E0 0.0 546 71 2 365 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Blochmanniella pennsylvanica (strain BPEN)
Q9HXJ4 0.0 535 74 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02RV7 0.0 535 74 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UWI8 0.0 535 74 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas aeruginosa (strain LESB58)
A6V0W0 0.0 533 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas aeruginosa (strain PA7)
Q886Z0 0.0 532 73 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4K6U9 0.0 531 73 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K7B6 0.0 531 73 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas fluorescens (strain Pf0-1)
Q1QTK8 0.0 530 72 1 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B1JDV8 0.0 527 72 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas putida (strain W619)
B0KPI7 0.0 527 72 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas putida (strain GB-1)
A4XY32 0.0 527 72 1 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas mendocina (strain ymp)
Q48LZ4 0.0 527 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B3PDM1 0.0 524 70 1 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Cellvibrio japonicus (strain Ueda107)
Q88PJ7 0.0 523 72 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VYT5 0.0 523 72 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C3K1L4 0.0 523 72 2 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas fluorescens (strain SBW25)
C1DE57 0.0 523 71 1 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4ZX23 0.0 522 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas syringae pv. syringae (strain B728a)
Q1IEI1 0.0 521 72 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas entomophila (strain L48)
P57374 0.0 520 66 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A1TZQ0 0.0 519 70 1 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6VV06 0.0 514 66 1 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Marinomonas sp. (strain MWYL1)
Q8K9P4 0.0 513 67 0 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q2SDW4 0.0 513 68 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Hahella chejuensis (strain KCTC 2396)
Q21KT3 2.7e-180 508 68 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B5EJF3 9.7e-180 506 68 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JC30 9.7e-180 506 68 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q8D1Y3 3.93e-174 492 65 0 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wigglesworthia glossinidia brevipalpis
A1AW46 2.16e-173 489 66 2 350 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ruthia magnifica subsp. Calyptogena magnifica
A5CX35 1.49e-165 469 63 2 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q0VNE0 1.61e-164 468 62 1 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q6FEM3 1.68e-163 465 64 1 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0V5G7 5.97e-163 464 62 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain AYE)
A3M211 5.97e-163 464 62 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VKR8 5.97e-163 464 62 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain SDF)
B2I3E5 5.97e-163 464 62 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain ACICU)
B7I5G7 5.97e-163 464 62 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain AB0057)
B7H069 5.97e-163 464 62 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain AB307-0294)
Q1QD18 6.47e-148 426 61 1 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FTW7 6.47e-148 426 61 1 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A0LDN3 1.15e-144 417 60 1 333 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q9A9W0 1.96e-140 407 56 0 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1GIC1 2.9e-136 396 57 0 350 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ruegeria sp. (strain TM1040)
A9HJ48 4.87e-136 395 57 2 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q0C4J3 1.59e-134 392 55 0 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Hyphomonas neptunium (strain ATCC 15444)
Q28R10 2.18e-134 391 56 0 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Jannaschia sp. (strain CCS1)
A5FX97 3.47e-134 390 58 2 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acidiphilium cryptum (strain JF-5)
Q5FUR7 9.85e-133 387 57 3 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Gluconobacter oxydans (strain 621H)
Q0BUK0 1.71e-132 387 56 0 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q4FNA0 3.14e-132 385 54 2 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pelagibacter ubique (strain HTCC1062)
A8LI72 5.71e-132 385 57 0 350 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q74D60 9.19e-132 384 53 2 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q2RWE4 1.32e-131 384 56 3 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5NR50 3.87e-131 383 56 2 342 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q67PA7 1.78e-128 376 50 1 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A1B323 3.08e-128 375 57 0 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Paracoccus denitrificans (strain Pd 1222)
Q5LQ99 4.49e-126 370 57 0 350 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B5YIQ4 3.05e-121 357 51 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q97I56 1.7e-120 355 51 1 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P58667 1.84e-120 355 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clostridium perfringens (strain 13 / Type A)
A7GSX5 2.2e-120 355 50 1 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8RA30 3.4e-120 354 54 1 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q1MSE5 5.51e-120 354 52 0 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Lawsonia intracellularis (strain PHE/MN1-00)
B7IYD0 9.89e-120 354 50 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain G9842)
A9VH61 1.72e-119 353 50 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus mycoides (strain KBAB4)
B7HPH8 1.92e-119 353 53 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain AH187)
B9IY45 2.49e-119 353 53 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain Q1)
Q730Q8 2.49e-119 353 53 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain ATCC 10987 / NRS 248)
Q818H8 3.35e-119 352 50 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HCQ3 3.35e-119 352 50 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain B4264)
C5D4Q3 6.48e-119 352 53 1 328 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Geobacillus sp. (strain WCH70)
Q6HDN9 8.27e-119 352 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1ES01 8.27e-119 352 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain 03BB102)
B7JN03 8.27e-119 352 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain AH820)
A0RIQ2 8.27e-119 352 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus thuringiensis (strain Al Hakam)
C3LKV7 8.27e-119 352 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8I5 8.27e-119 352 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus anthracis (strain A0248)
A4IQZ4 1.24e-118 351 49 3 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Geobacillus thermodenitrificans (strain NG80-2)
Q81LV7 1.28e-118 351 52 0 325 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus anthracis
Q634Q9 1.34e-118 351 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain ZK / E33L)
Q9KD18 2.92e-118 350 52 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B1HSS4 4.52e-118 350 49 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Lysinibacillus sphaericus (strain C3-41)
Q895K3 1.56e-117 347 51 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clostridium tetani (strain Massachusetts / E88)
Q5KX35 4.36e-117 347 50 2 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Geobacillus kaustophilus (strain HTA426)
B7GH89 5.76e-117 347 51 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q8RG40 1.92e-116 345 48 1 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5WHB2 8.67e-116 343 52 1 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shouchella clausii (strain KSM-K16)
P54482 1.07e-115 344 52 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus subtilis (strain 168)
A7Z6S2 1.36e-115 343 52 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A8FF87 2.41e-115 343 51 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus pumilus (strain SAFR-032)
Q71ZM9 2.87e-115 342 52 1 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Listeria monocytogenes serotype 4b (strain F2365)
C1L2Z7 5.46e-115 342 52 1 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Listeria monocytogenes serotype 4b (strain CLIP80459)
Q65HA9 8.26e-115 341 52 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9E6U1 1.26e-114 341 49 2 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Macrococcus caseolyticus (strain JCSC5402)
Q6AP32 1.33e-114 340 49 2 336 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B8I6E1 1.43e-114 340 48 1 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
P58668 2.06e-114 340 50 2 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
C4L3K5 1.08e-113 338 49 2 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
C6BYK9 1.18e-113 338 50 1 328 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q72CD9 4.99e-113 337 53 1 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A5FS85 1.44e-110 330 49 1 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A6Q1U2 8.87e-110 328 52 2 316 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitratiruptor sp. (strain SB155-2)
Q3ZZC9 1.08e-109 327 49 1 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Dehalococcoides mccartyi (strain CBDB1)
B1YLA2 1.48e-109 328 49 1 328 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A4XLZ4 8.6e-109 325 49 1 309 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
C0ZF58 1.14e-108 325 48 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B2V7Y2 3.58e-108 324 45 1 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sulfurihydrogenibium sp. (strain YO3AOP1)
A6QC65 5.53e-108 323 51 2 316 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sulfurovum sp. (strain NBC37-1)
Q30TM4 7.5e-108 323 51 2 320 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q8G7Y6 3.87e-106 320 43 3 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bifidobacterium longum (strain NCC 2705)
Q82K43 4.78e-106 320 46 1 326 3 ispG1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
C0QRI5 7.3e-106 318 47 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Persephonella marina (strain DSM 14350 / EX-H1)
O67496 3.49e-105 316 47 1 348 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aquifex aeolicus (strain VF5)
Q9X7W2 8.22e-105 316 44 1 352 3 ispG1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9KYR9 1.66e-104 315 46 1 326 3 ispG2 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B2A390 2.01e-104 314 44 2 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q47RY0 5.86e-104 314 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermobifida fusca (strain YX)
Q5YS74 5.98e-103 311 45 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nocardia farcinica (strain IFM 10152)
A1R501 6.44e-103 311 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Paenarthrobacter aurescens (strain TC1)
B1VGA4 7.93e-103 311 47 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
A8L6E2 8.57e-103 311 46 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Parafrankia sp. (strain EAN1pec)
B8HG44 1.45e-102 311 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A8M723 1.92e-102 310 45 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salinispora arenicola (strain CNS-205)
Q82ML3 1.93e-102 310 46 1 326 3 ispG2 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B5Z6Z7 3.39e-102 309 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain G27)
Q1CTP7 3.98e-102 308 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain HPAG1)
O25342 4.3e-102 308 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain ATCC 700392 / 26695)
A0JUS8 5.01e-102 309 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Arthrobacter sp. (strain FB24)
Q6NGL3 6.84e-102 309 45 1 351 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B6JLL3 9.2e-102 308 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain P12)
B2UTK0 2.19e-101 306 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain Shi470)
Q9ZLL0 2.31e-101 306 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain J99 / ATCC 700824)
Q6A7L2 2.36e-101 307 46 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Cutibacterium acnes (strain DSM 16379 / KPA171202)
A9WR14 3.3e-101 307 44 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
B9LA27 3.47e-101 306 49 3 319 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A0LV34 9.14e-101 306 45 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A5CT01 2.18e-100 305 43 1 357 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B0RDZ5 3.4e-100 304 43 1 357 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clavibacter sepedonicus
Q8FP82 5.32e-100 304 44 2 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8NP12 5.73e-100 304 44 2 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
C1B2V4 6.55e-100 304 45 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodococcus opacus (strain B4)
A4X4L9 7.5e-100 304 44 1 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q4JV28 1.19e-99 303 44 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium jeikeium (strain K411)
B1VYP5 3.8e-99 302 44 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B2GKS3 5.59e-99 301 46 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q7TXN6 1.02e-98 301 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WKG3 1.11e-98 301 44 1 352 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKG2 1.11e-98 301 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U6M2 1.11e-98 301 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFY4 1.11e-98 301 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KML3 1.11e-98 301 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q83N18 1.84e-98 300 43 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Tropheryma whipplei (strain Twist)
Q83NE4 1.84e-98 300 43 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Tropheryma whipplei (strain TW08/27)
Q6AEX9 3.81e-98 299 45 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leifsonia xyli subsp. xyli (strain CTCB07)
B4U9V3 4.54e-98 298 44 0 344 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Hydrogenobaculum sp. (strain Y04AAS1)
Q7VI04 8.34e-98 297 47 2 313 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q0RDR2 8.36e-98 298 44 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q2J717 4.01e-96 294 45 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q73VS3 5.25e-95 291 43 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q17XU2 1.43e-94 289 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter acinonychis (strain Sheeba)
Q8EUI6 5.82e-93 285 43 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Malacoplasma penetrans (strain HF-2)
A8F4Y8 8.11e-93 284 44 3 322 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B7IFY1 1.24e-92 284 42 3 318 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermosipho africanus (strain TCF52B)
Q9CBU5 3.78e-90 279 44 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium leprae (strain TN)
B8ZRU5 3.78e-90 279 44 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium leprae (strain Br4923)
B1LC43 2.16e-88 273 43 5 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermotoga sp. (strain RQ2)
A5IIP2 2.16e-88 273 43 5 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9WZZ3 3.71e-88 272 44 5 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A8FLB6 1.14e-86 269 40 3 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q7M8Z2 1.55e-86 269 47 2 313 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A1VZ41 2.11e-86 268 40 3 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PPM1 2.32e-86 268 40 3 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5HV95 2.89e-86 268 40 3 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni (strain RM1221)
A7H4D8 6.86e-86 267 40 3 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B9KD64 4.97e-85 265 43 2 318 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A7ZCT9 1.72e-84 263 44 3 339 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter concisus (strain 13826)
A7GZ54 2.3e-84 263 44 3 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter curvus (strain 525.92)
Q7NBH3 4.74e-83 259 41 1 316 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
A0RPL8 4.81e-81 254 43 2 316 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter fetus subsp. fetus (strain 82-40)
B0C6E1 3.41e-77 246 39 8 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Acaryochloris marina (strain MBIC 11017)
B1WQF1 3.01e-76 244 39 8 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q10W70 4.55e-76 243 39 9 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Trichodesmium erythraeum (strain IMS101)
Q8DK70 7.73e-75 240 38 8 354 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B1XHZ7 7.76e-75 240 39 8 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B7KJJ4 1.31e-74 239 38 8 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Gloeothece citriformis (strain PCC 7424)
P73672 1.98e-74 239 38 8 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B7K5R5 2e-74 239 38 8 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Rippkaea orientalis (strain PCC 8801 / RF-1)
B2J1G1 1.83e-73 237 38 8 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B0JJJ8 3.47e-73 236 37 11 393 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
P58666 5.95e-73 235 39 8 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B8HSI6 7.9e-73 235 38 8 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q7VBS7 1.03e-72 234 38 9 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q3MG27 1.26e-72 234 38 8 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Trichormus variabilis (strain ATCC 29413 / PCC 7937)
O83460 1.97e-72 234 39 3 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Treponema pallidum (strain Nichols)
Q3AK30 2.95e-72 233 39 9 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain CC9605)
Q73N90 4.05e-72 233 38 4 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q2JS69 6.73e-72 233 39 10 351 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain JA-3-3Ab)
Q0I9J4 2.08e-71 231 39 9 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain CC9311)
Q3AXP3 1.46e-70 229 40 9 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain CC9902)
Q7V215 1.83e-70 229 38 8 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q5N3W3 4.56e-70 228 37 9 350 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QC4 4.56e-70 228 37 9 350 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q2JPZ9 1.01e-69 227 37 10 387 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain JA-2-3B'a(2-13))
Q7U712 5.61e-69 225 38 9 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Parasynechococcus marenigrum (strain WH8102)
Q7NFA4 1.36e-66 218 36 8 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7V7G9 1.26e-65 216 38 9 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Prochlorococcus marinus (strain MIT 9313)
Q1IRS5 1.05e-61 206 37 12 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Koribacter versatilis (strain Ellin345)
Q84GJ3 2.21e-61 205 38 11 373 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermus thermophilus
Q72H18 2.21e-61 205 38 11 373 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q7UWC8 1.88e-60 202 38 12 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q5SLI8 1.9e-60 203 38 11 373 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q9RXC9 2.31e-60 203 36 11 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q604Q5 6.16e-59 199 35 10 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5ETI5 2.29e-58 198 35 12 382 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q1H0U9 2.82e-58 198 36 13 378 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q04UL2 6.13e-58 202 42 6 274 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q04UL2 1.19e-12 72 35 3 106 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q04YW2 7.01e-58 202 42 6 274 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04YW2 1.28e-12 72 35 3 106 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q8F1H5 2.93e-57 200 42 6 274 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8F1H5 4.96e-14 77 37 3 106 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72TR2 3.68e-57 200 42 6 274 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q72TR2 5.43e-14 77 37 3 106 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A4YKQ8 4.53e-57 195 34 12 382 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bradyrhizobium sp. (strain ORS 278)
B6JA27 7.97e-57 194 35 14 385 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q6G1X4 1.74e-56 192 35 10 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B4RMG4 1.94e-56 193 33 12 396 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria gonorrhoeae (strain NCCP11945)
Q5F913 1.94e-56 193 33 12 396 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B3QBC6 3.82e-56 192 35 13 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain TIE-1)
Q89VV9 4.12e-56 192 33 10 377 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6NCF3 5.13e-56 192 35 13 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A9IYW1 6.41e-56 191 35 11 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q9JU34 7.12e-56 191 34 11 374 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9LZN8 7.12e-56 191 34 11 374 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria meningitidis serogroup C (strain 053442)
A1KUD8 7.43e-56 191 34 11 374 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q6G104 7.67e-56 191 35 11 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bartonella quintana (strain Toulouse)
Q9JZ40 9.38e-56 191 34 11 374 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5P7B3 9.41e-56 191 35 10 376 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B2SG03 1.29e-55 190 35 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. mediasiatica (strain FSC147)
Q0BMA6 1.33e-55 190 35 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. holarctica (strain OSU18)
Q21C20 6e-55 189 35 14 386 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain BisB18)
Q5NH64 8.67e-55 188 35 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14IL6 8.67e-55 188 35 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. tularensis (strain FSC 198)
Q3SVD0 9.27e-55 189 34 11 382 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A0Q6U8 9.94e-55 188 35 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. novicida (strain U112)
Q2J2S7 1.18e-54 188 34 13 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain HaA2)
A3NA54 1.85e-54 187 36 12 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia pseudomallei (strain 668)
Q63UT3 1.91e-54 187 36 12 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia pseudomallei (strain K96243)
A3NVX1 1.91e-54 187 36 12 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia pseudomallei (strain 1106a)
A1V4K1 1.91e-54 187 36 12 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia mallei (strain SAVP1)
A2S2A2 1.91e-54 187 36 12 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia mallei (strain NCTC 10229)
A3MK75 1.91e-54 187 36 12 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia mallei (strain NCTC 10247)
Q3JRQ3 3.31e-54 187 36 12 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia pseudomallei (strain 1710b)
Q62JW4 3.31e-54 187 36 12 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia mallei (strain ATCC 23344)
B2FL74 4.17e-54 187 34 9 374 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Stenotrophomonas maltophilia (strain K279a)
Q1QQI9 4.92e-54 187 33 9 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
P58669 6.27e-54 186 35 12 385 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B4EAW9 1.09e-53 186 36 10 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q0AE42 1.17e-53 185 36 9 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q9PKY3 2.19e-53 189 40 7 281 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia muridarum (strain MoPn / Nigg)
Q9PKY3 2.21e-10 65 36 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia muridarum (strain MoPn / Nigg)
Q07V91 2.3e-53 185 33 13 384 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain BisA53)
Q47BR6 2.42e-53 184 34 13 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Dechloromonas aromatica (strain RCB)
B2U9U9 3.52e-53 184 35 14 390 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ralstonia pickettii (strain 12J)
B2IE63 3.66e-53 184 35 12 370 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q7NS88 3.82e-53 184 35 13 385 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B4SRZ0 2.13e-52 182 33 9 381 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Stenotrophomonas maltophilia (strain R551-3)
A1UR54 2.79e-52 182 36 10 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B0B9G5 6.53e-52 185 39 7 281 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B0B9G5 4.47e-10 64 34 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q029T9 9.15e-52 180 38 13 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Solibacter usitatus (strain Ellin6076)
O84060 9.36e-52 184 39 7 281 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
O84060 2.94e-10 65 34 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KMW4 1.03e-51 184 39 7 281 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q3KMW4 3.02e-10 65 34 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0BB44 1.17e-51 184 39 7 281 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0BB44 4.47e-10 64 34 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q7W6P6 1.46e-51 180 35 12 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHN0 1.46e-51 180 35 12 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B1YR44 2.34e-51 180 35 10 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia ambifaria (strain MC40-6)
Q2P3M7 2.48e-51 179 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q7VWL0 2.65e-51 179 35 12 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q82XV0 5.5e-51 178 34 11 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5H0N8 6.68e-51 178 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q8P9R7 2.06e-50 177 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RTS9 2.06e-50 177 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas campestris pv. campestris (strain B100)
Q4UTW8 2.06e-50 177 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas campestris pv. campestris (strain 8004)
Q6MD85 2.81e-50 181 42 7 272 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Protochlamydia amoebophila (strain UWE25)
Q6MD85 9.22e-12 70 27 1 131 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Protochlamydia amoebophila (strain UWE25)
A6WXY9 4.68e-50 176 34 11 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8FYT2 4.87e-50 176 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella suis biovar 1 (strain 1330)
Q57BA5 5.13e-50 176 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella abortus biovar 1 (strain 9-941)
Q2YLG4 5.13e-50 176 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella abortus (strain 2308)
B2S7K6 5.13e-50 176 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella abortus (strain S19)
Q8YJ17 5.35e-50 176 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RF32 5.35e-50 176 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella melitensis biotype 2 (strain ATCC 23457)
Q9PAE3 7.16e-50 176 34 11 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xylella fastidiosa (strain 9a5c)
A9M820 7.89e-50 176 34 11 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q3BUK3 8.07e-50 176 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
C3MAL6 8.93e-50 175 34 13 382 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A9WWQ2 9.94e-50 175 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8PLJ8 1.08e-49 175 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas axonopodis pv. citri (strain 306)
Q87A73 4.69e-49 173 34 11 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8KG23 4.91e-49 179 39 8 282 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8KG23 1.78e-17 87 25 11 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q823I7 1.25e-48 176 38 5 280 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q823I7 7.26e-10 63 29 2 111 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q6K8J4 2.03e-48 177 39 6 272 2 ISPG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic Oryza sativa subsp. japonica
Q6K8J4 4.78e-09 61 27 2 107 2 ISPG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic Oryza sativa subsp. japonica
Q254D2 2.8e-48 175 38 5 284 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia felis (strain Fe/C-56)
Q254D2 2.53e-10 65 28 3 128 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia felis (strain Fe/C-56)
B3PR71 3.03e-48 171 33 13 362 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium etli (strain CIAT 652)
F4K0E8 3.83e-48 176 38 7 280 1 ISPG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic Arabidopsis thaliana
F4K0E8 5.94e-08 58 28 2 100 1 ISPG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic Arabidopsis thaliana
Q5L669 1.16e-47 173 38 5 280 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia abortus (strain DSM 27085 / S26/3)
Q5L669 2.59e-11 68 30 2 111 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia abortus (strain DSM 27085 / S26/3)
A6L089 4.39e-47 172 38 7 292 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A6L089 1e-08 60 30 3 109 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q9Z8H0 7.21e-47 171 39 5 285 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia pneumoniae
Q9Z8H0 3.09e-11 68 30 2 111 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia pneumoniae
Q2K333 7.73e-47 167 33 14 384 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8A4T0 1.37e-46 171 37 6 286 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8A4T0 2.42e-08 59 30 3 110 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6UE79 3.07e-46 166 34 12 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sinorhizobium medicae (strain WSM419)
Q98FG0 9.11e-46 164 34 13 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5L7W2 1.76e-45 168 35 7 308 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q5L7W2 8.61e-08 57 28 2 108 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q92L19 2.59e-45 163 33 12 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium meliloti (strain 1021)
Q64N34 3.25e-45 167 35 7 308 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides fragilis (strain YCH46)
Q64N34 5.78e-08 58 29 2 108 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides fragilis (strain YCH46)
Q1MAC5 4.5e-45 163 32 14 377 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7MVT7 4.71e-45 166 35 7 301 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q7MVT7 6.74e-09 61 32 3 109 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B5ZUA0 8.16e-45 162 31 13 357 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q5PAJ1 9.41e-45 162 31 14 405 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Anaplasma marginale (strain St. Maries)
C1DD43 2.81e-44 160 34 12 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Laribacter hongkongensis (strain HLHK9)
A6LGR5 3.32e-44 164 36 8 320 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A6LGR5 3.64e-10 65 31 4 135 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q5GRK4 1.16e-43 159 30 10 407 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolbachia sp. subsp. Brugia malayi (strain TRS)
B9JV07 1.21e-43 159 31 11 339 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q3YRZ7 1.87e-43 159 31 12 384 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ehrlichia canis (strain Jake)
Q5HB57 2.5e-43 158 31 13 385 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ehrlichia ruminantium (strain Welgevonden)
Q5FHA6 2.98e-43 158 31 13 385 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ehrlichia ruminantium (strain Gardel)
B9JE02 4.18e-43 157 30 11 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
P58665 5.31e-43 157 31 11 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Agrobacterium fabrum (strain C58 / ATCC 33970)
Q73IP1 1.94e-42 156 31 9 388 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolbachia pipientis wMel
C0R5E5 5.52e-42 155 31 9 388 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolbachia sp. subsp. Drosophila simulans (strain wRi)
B2UKT9 8.34e-42 157 35 6 278 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
B2UKT9 1.43e-11 69 29 4 159 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
B3CNN4 7.65e-41 152 30 9 391 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolbachia pipientis subsp. Culex pipiens (strain wPip)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09105
Feature type CDS
Gene ispG
Product flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
Location 1982577 - 1983698 (strand: -1)
Length 1122 (nucleotides) / 373 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_511
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04551 GcpE protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0821 Lipid transport and metabolism (I) I 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase IspG/GcpE

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03526 (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3] Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites		 C5 isoprenoid biosynthesis, non-mevalonate pathway

Protein Sequence

MHKESPIIRRKSTRIYVGNVPIGDGAPIAVQSMTNTRTTDVEATVNQIKSLERVGVDIVRVSVPTMDAAEAFKLIKQQVKVPLVADIHFDYRIALKVAEYGVDCLRINPGNIGNEERIRQVVDCARDRNIPIRIGVNGGSLEKDIQEKYGEPTPEALVESAMRHVDILDKLNFDQFKVSVKASDVFLAVDSYRLLAKKIDQPLHLGITEAGGARAGSVKSAIGLGILLSEGIGDTLRISLAADPVEEVKVGFDILKSLRIRSRGINFIACPTCSRQEFDVIGTVNELEQRLEDIITPMDVSIIGCVVNGPGEAEVSTLGVTGAKTRSGFYEDGVRQKERLDNSNMIDLLEAKIRTKAAMLDGNLRININQLDK

Flanking regions ( +/- flanking 50bp)

TAATCTGACTATACATTTGAGCAAGCATGGAAGCATGGGAGAATTAATCAATGCATAAAGAATCACCTATTATTCGTCGTAAATCGACGCGAATTTATGTTGGTAATGTACCTATTGGCGATGGGGCTCCTATCGCGGTACAGTCGATGACGAACACACGAACAACAGACGTTGAAGCGACTGTAAACCAGATTAAGTCTCTGGAACGTGTTGGGGTGGATATTGTACGTGTTTCTGTACCAACTATGGATGCGGCTGAAGCATTCAAACTAATTAAGCAACAAGTGAAAGTACCTTTGGTCGCTGATATTCATTTTGATTATCGTATTGCACTTAAAGTTGCTGAATATGGTGTCGATTGTTTACGTATTAATCCTGGTAATATTGGTAATGAAGAGCGTATTCGTCAAGTTGTCGATTGTGCCCGGGATCGTAATATTCCCATTCGTATTGGTGTGAATGGGGGGTCACTAGAGAAAGATATTCAAGAAAAGTATGGTGAGCCAACCCCTGAAGCGCTAGTTGAATCGGCTATGCGCCACGTTGATATCTTAGATAAATTGAACTTTGATCAGTTTAAAGTCAGTGTAAAAGCTTCTGACGTTTTCCTTGCTGTTGATTCTTATCGTTTATTAGCGAAGAAAATTGATCAGCCTTTACATTTAGGGATCACCGAAGCTGGTGGTGCAAGAGCCGGATCAGTGAAATCAGCTATTGGCCTTGGGATCCTTCTATCAGAAGGTATTGGTGATACTTTACGTATCTCTTTAGCCGCAGATCCGGTTGAAGAAGTAAAAGTTGGCTTTGATATCTTAAAATCATTACGTATTCGCTCTCGTGGTATCAATTTTATTGCTTGTCCAACATGCTCTCGTCAAGAGTTTGATGTTATTGGTACAGTTAATGAATTAGAACAACGTCTTGAAGATATCATTACACCAATGGATGTTTCTATTATTGGCTGTGTGGTTAATGGTCCTGGTGAAGCGGAGGTTTCTACACTAGGTGTAACCGGAGCTAAAACACGCAGTGGTTTTTATGAAGACGGTGTAAGACAAAAAGAGCGTCTTGATAATAGTAATATGATTGATTTATTAGAGGCGAAAATCCGTACAAAAGCGGCAATGCTTGACGGCAACCTCCGAATTAATATAAATCAATTGGATAAATAACACGCAATTAACAGGCTCATTAACTAATGAGTCTGTATTACTATTGATTT