Homologs in group_1716

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11630 FBDBKF_11630 60.0 Morganella morganii S1 marR DNA-binding transcriptional regulator, MarR family
EHELCC_17550 EHELCC_17550 60.0 Morganella morganii S2 marR DNA-binding transcriptional regulator, MarR family
NLDBIP_18760 NLDBIP_18760 60.0 Morganella morganii S4 marR DNA-binding transcriptional regulator, MarR family
LHKJJB_17990 LHKJJB_17990 60.0 Morganella morganii S3 marR DNA-binding transcriptional regulator, MarR family
HKOGLL_18660 HKOGLL_18660 60.0 Morganella morganii S5 marR DNA-binding transcriptional regulator, MarR family
F4V73_RS08050 F4V73_RS08050 60.0 Morganella psychrotolerans - MarR family transcriptional regulator

Distribution of the homologs in the orthogroup group_1716

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1716

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O33817 1.99e-07 50 31 0 108 4 None Putative transcriptional regulatory protein for hcr operon Thauera aromatica
P42193 1.92e-06 48 30 0 88 4 papX HTH-type transcriptional regulator PapX Escherichia coli
P62088 5.06e-06 47 27 0 91 4 prsX HTH-type transcriptional regulator PrsX Escherichia coli
P62089 5.06e-06 47 27 0 91 4 prsX HTH-type transcriptional regulator PrsX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O34949 4.56e-05 44 29 0 96 4 ykoM Uncharacterized HTH-type transcriptional regulator YkoM Bacillus subtilis (strain 168)
O31541 0.000113 43 25 1 107 1 yetL HTH-type transcriptional repressor YetL Bacillus subtilis (strain 168)
P42195 0.000187 42 26 1 111 4 pecS HTH-type transcriptional regulator PecS Dickeya dadantii (strain 3937)
P0A2T4 0.000338 41 27 1 110 4 marR Multiple antibiotic resistance protein MarR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T5 0.000338 41 27 1 110 3 marR Multiple antibiotic resistance protein MarR Salmonella typhi

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08980
Feature type CDS
Gene -
Product MarR family transcriptional regulator
Location 1957841 - 1958281 (strand: 1)
Length 441 (nucleotides) / 146 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1716
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12802 MarR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1846 Transcription (K) K DNA-binding transcriptional regulator, MarR family

Protein Sequence

MEQLELENALSLLQCTLVAQRTRYTPEQVTWGQYDILELLRLRGDLTPSQLCEILAISRQNLSKFMRGLKSLGFIAQDRSKKDKRELITHLTDEGKAFLARAALGRKQNAQKLQAQLTPAEQAMFIELSHKVINALIADKLPTEPD

Flanking regions ( +/- flanking 50bp)

GAGCTGTTATTATTAACTTCAATTAATTTGATAGAAAAATGTAGGTACTAATGGAGCAACTTGAGCTAGAAAATGCCCTATCGCTTTTACAGTGTACTCTGGTTGCACAACGCACCCGTTATACACCAGAGCAAGTAACTTGGGGACAATATGATATTTTAGAATTATTGCGTTTACGCGGTGATTTAACGCCCTCTCAACTTTGTGAAATTTTAGCTATCTCACGCCAAAATTTATCTAAGTTTATGCGAGGATTAAAATCATTAGGTTTTATTGCTCAGGATCGTTCTAAGAAAGATAAACGTGAATTAATTACGCATTTAACAGATGAAGGTAAAGCTTTTTTAGCAAGAGCCGCTTTAGGCCGAAAACAGAACGCACAGAAGCTACAAGCGCAATTAACACCTGCAGAACAAGCTATGTTTATTGAATTGAGTCATAAAGTTATTAACGCACTAATAGCGGATAAGTTACCTACAGAGCCTGATTAATGCGACTGCTTTAATGGTTTTAGTAACCCTTCTAAGCCATCAATTTTAAT