Homologs in group_1942

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14200 FBDBKF_14200 74.5 Morganella morganii S1 yfbV terminus macrodomain insulation protein YfbV
EHELCC_08080 EHELCC_08080 74.5 Morganella morganii S2 yfbV terminus macrodomain insulation protein YfbV
NLDBIP_08405 NLDBIP_08405 74.5 Morganella morganii S4 yfbV terminus macrodomain insulation protein YfbV
LHKJJB_05860 LHKJJB_05860 74.5 Morganella morganii S3 yfbV terminus macrodomain insulation protein YfbV
HKOGLL_05055 HKOGLL_05055 74.5 Morganella morganii S5 yfbV terminus macrodomain insulation protein YfbV
F4V73_RS02730 F4V73_RS02730 77.2 Morganella psychrotolerans yfbV terminus macrodomain insulation protein YfbV

Distribution of the homologs in the orthogroup group_1942

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1942

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EZD8 2.8e-108 307 100 0 151 3 PMI1770 UPF0208 membrane protein PMI1770 Proteus mirabilis (strain HI4320)
Q7N2I2 1.22e-83 245 77 0 145 3 plu3094 UPF0208 membrane protein plu3094 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8GLH3 5.91e-83 243 78 0 142 3 yfbV UPF0208 membrane protein YfbV Photorhabdus temperata
A1JLD6 1.78e-73 219 71 0 142 3 YE1335 UPF0208 membrane protein YE1335 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2K829 1.06e-71 215 70 0 142 3 YPTS_2690 UPF0208 membrane protein YPTS_2690 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q668Z2 1.06e-71 215 70 0 142 3 YPTB2595 UPF0208 membrane protein YPTB2595 Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JGK5 1.06e-71 215 70 0 142 3 YPK_1552 UPF0208 membrane protein YPK_1552 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FGP5 1.06e-71 215 70 0 142 3 YpsIP31758_1444 UPF0208 membrane protein YpsIP31758_1444 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GH23 1.15e-71 214 68 0 142 3 Spro_3315 UPF0208 membrane protein Spro_3315 Serratia proteamaculans (strain 568)
Q8ZDJ8 5.15e-71 213 70 0 142 3 YPO2564 UPF0208 membrane protein YPO2564/y1623/YP_2375 Yersinia pestis
Q1CHP4 5.15e-71 213 70 0 142 3 YPN_2157 UPF0208 membrane protein YPN_2157 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C6A2 5.15e-71 213 70 0 142 3 YPA_2054 UPF0208 membrane protein YPA_2054 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TM43 5.15e-71 213 70 0 142 3 YPDSF_1972 UPF0208 membrane protein YPDSF_1972 Yersinia pestis (strain Pestoides F)
A9R6M8 5.15e-71 213 70 0 142 3 YpAngola_A1824 UPF0208 membrane protein YpAngola_A1824 Yersinia pestis bv. Antiqua (strain Angola)
C6DA53 9.72e-71 212 69 0 142 3 PC1_2779 UPF0208 membrane protein PC1_2779 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5B8J9 1.15e-70 212 69 0 142 3 NT01EI_2692 UPF0208 membrane protein NT01EI_2692 Edwardsiella ictaluri (strain 93-146)
A6TBY2 3.66e-70 211 66 0 151 3 KPN78578_26420 UPF0208 membrane protein KPN78578_26420 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNU5 3.66e-70 211 66 0 151 3 KPK_1462 UPF0208 membrane protein KPK_1462 Klebsiella pneumoniae (strain 342)
Q8ZND7 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TQ70 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella schwarzengrund (strain CVM19633)
B5BCL0 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella paratyphi A (strain AKU_12601)
C0Q030 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella paratyphi C (strain RKS4594)
A9N4B4 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PN46 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZ08 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella newport (strain SL254)
B4TBK3 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella heidelberg (strain SL476)
B5RCG1 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R317 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella enteritidis PT4 (strain P125109)
B5FPH7 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella dublin (strain CT_02021853)
Q57M19 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella choleraesuis (strain SC-B67)
B5EZL8 4.87e-70 211 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella agona (strain SL483)
A7MH29 5.2e-70 210 66 0 151 3 ESA_00924 UPF0208 membrane protein ESA_00924 Cronobacter sakazakii (strain ATCC BAA-894)
Q8Z521 9.7e-70 210 65 0 151 3 yfbV UPF0208 membrane protein YfbV Salmonella typhi
Q6D2Q7 1.02e-69 210 67 0 142 3 ECA3038 UPF0208 membrane protein ECA3038 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3YZR6 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Shigella sonnei (strain Ss046)
Q32DP4 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Shigella dysenteriae serotype 1 (strain Sd197)
Q31YG5 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Shigella boydii serotype 4 (strain Sb227)
B2TW76 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LLP9 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain SMS-3-5 / SECEC)
B6I7L7 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain SE11)
B7N5Q7 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8D9 1.05e-69 209 65 0 151 1 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain K12)
B1IXP7 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TFF1 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A2G3 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O9:H4 (strain HS)
B1X906 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain K12 / DH10B)
C4ZVI8 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5X4 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O8 (strain IAI1)
B7MXH4 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O81 (strain ED1a)
B7NNX4 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXT5 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8E0 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O157:H7
B7LBE9 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain 55989 / EAEC)
B7UFV3 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPA9 1.05e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O139:H28 (strain E24377A / ETEC)
A8ADU3 1.19e-69 209 64 0 151 3 CKO_00500 UPF0208 membrane protein CKO_00500 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7LM37 2.44e-69 209 65 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q83KB1 4.03e-69 208 65 0 151 3 yfbV UPF0208 membrane protein YfbV Shigella flexneri
Q0T2J2 4.03e-69 208 65 0 151 3 yfbV UPF0208 membrane protein YfbV Shigella flexneri serotype 5b (strain 8401)
A4WCS4 5.36e-69 208 65 0 151 3 Ent638_2839 UPF0208 membrane protein Ent638_2839 Enterobacter sp. (strain 638)
Q8FFJ2 2.2e-68 206 64 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1R9C0 5.07e-68 205 64 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain UTI89 / UPEC)
A1ADE4 5.07e-68 205 64 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O1:K1 / APEC
B7MG59 5.07e-68 205 64 0 151 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O45:K1 (strain S88 / ExPEC)
Q2NSJ5 2.42e-66 201 63 0 142 3 SG1605 UPF0208 membrane protein SG1605 Sodalis glossinidius (strain morsitans)
Q8DAH7 3.75e-43 142 48 1 142 3 VV1_2222 UPF0208 membrane protein VV1_2222 Vibrio vulnificus (strain CMCP6)
Q7MJM9 3.75e-43 142 48 1 142 3 VV2132 UPF0208 membrane protein VV2132 Vibrio vulnificus (strain YJ016)
Q6LNF7 1.89e-42 140 47 1 146 3 PBPRA2797 UPF0208 membrane protein PBPRA2797 Photobacterium profundum (strain SS9)
A7MVD8 5.2e-42 139 46 1 142 3 VIBHAR_02941 UPF0208 membrane protein VIBHAR_02941 Vibrio campbellii (strain ATCC BAA-1116)
B6EI58 7.15e-42 139 43 1 146 3 VSAL_I2111 UPF0208 membrane protein VSAL_I2111 Aliivibrio salmonicida (strain LFI1238)
B5FC41 9.49e-42 139 44 1 146 3 VFMJ11_0876 UPF0208 membrane protein VFMJ11_0876 Aliivibrio fischeri (strain MJ11)
Q5E6L3 9.49e-42 139 44 1 146 3 VF_0838 UPF0208 membrane protein VF_0838 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87MZ5 1.1e-41 139 47 1 142 3 VP2081 UPF0208 membrane protein VP2081 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VLV8 4.51e-41 137 45 1 142 3 VS_0999 UPF0208 membrane protein VS_0999 Vibrio atlanticus (strain LGP32)
Q9KT06 2.26e-39 133 45 1 142 3 VC_1099 UPF0208 membrane protein VC_1099 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CMV2 5.46e-36 124 42 1 145 3 PM0703 UPF0208 membrane protein PM0703 Pasteurella multocida (strain Pm70)
P44127 5.46e-36 124 43 1 146 3 HI_1205 UPF0208 membrane protein HI_1205 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UCQ5 2.95e-35 122 43 2 146 3 CGSHiEE_06015 UPF0208 membrane protein CGSHiEE_06015 Haemophilus influenzae (strain PittEE)
Q4QL94 2.95e-35 122 43 2 146 3 NTHI1376 UPF0208 membrane protein NTHI1376 Haemophilus influenzae (strain 86-028NP)
Q8ED56 8.97e-27 100 39 1 144 3 SO_2914 UPF0208 membrane protein SO_2914 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VKY8 6.61e-26 98 41 3 131 3 HD_1715 UPF0208 membrane protein HD_1715 Haemophilus ducreyi (strain 35000HP / ATCC 700724)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08680
Feature type CDS
Gene yfbV
Product terminus macrodomain insulation protein YfbV
Location 1896466 - 1896921 (strand: -1)
Length 456 (nucleotides) / 151 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1942
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04217 Protein of unknown function, DUF412

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3092 Function unknown (S) S Uncharacterized membrane protein YfbV, UPF0208 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09899 uncharacterized protein - -

Protein Sequence

MNEPTVTPPGFFKKLRLGNEYLKTWPVEKQLAPVFPENRMIKATRFGIRYMPPIAIFTLTWQIALGGDLGPAITTALFACSLPMQGLWWLGKRAATPLPAVLLNWFYEIREKFEQAGIALAPVEKTPTYLSLAHLLKRAFKQLDRSFLDDV

Flanking regions ( +/- flanking 50bp)

TCTTTATAGATGTTTTTTAAAAGTTATAGAAAAAATTGATTGAGGTCATTATGAACGAACCGACAGTGACTCCCCCAGGTTTCTTCAAAAAGTTACGCCTAGGGAACGAGTATCTAAAAACCTGGCCGGTTGAGAAGCAATTAGCCCCAGTTTTTCCTGAAAATAGAATGATAAAAGCAACGCGTTTTGGCATACGTTATATGCCTCCTATCGCTATTTTTACATTAACCTGGCAAATTGCATTAGGTGGCGATTTGGGGCCGGCGATCACTACTGCACTTTTTGCCTGTAGCCTGCCAATGCAAGGATTATGGTGGTTAGGAAAACGCGCTGCAACGCCATTACCCGCGGTGTTACTCAATTGGTTTTATGAAATTCGTGAAAAATTTGAGCAAGCGGGTATTGCATTAGCCCCAGTAGAAAAGACGCCAACCTATCTCTCATTAGCGCATTTGCTTAAACGTGCTTTTAAGCAACTTGATCGCTCTTTTCTTGATGATGTGTAGAACATTTGTTCTACCTTCTTCATGGGTTATTTAATGGATTAAAATTACCC