Homologs in group_1942

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14200 FBDBKF_14200 100.0 Morganella morganii S1 yfbV terminus macrodomain insulation protein YfbV
EHELCC_08080 EHELCC_08080 100.0 Morganella morganii S2 yfbV terminus macrodomain insulation protein YfbV
NLDBIP_08405 NLDBIP_08405 100.0 Morganella morganii S4 yfbV terminus macrodomain insulation protein YfbV
HKOGLL_05055 HKOGLL_05055 100.0 Morganella morganii S5 yfbV terminus macrodomain insulation protein YfbV
F4V73_RS02730 F4V73_RS02730 88.7 Morganella psychrotolerans yfbV terminus macrodomain insulation protein YfbV
PMI_RS08680 PMI_RS08680 74.5 Proteus mirabilis HI4320 yfbV terminus macrodomain insulation protein YfbV

Distribution of the homologs in the orthogroup group_1942

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1942

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EZD8 1.38e-79 234 73 0 151 3 PMI1770 UPF0208 membrane protein PMI1770 Proteus mirabilis (strain HI4320)
Q8GLH3 4.9e-78 231 73 0 151 3 yfbV UPF0208 membrane protein YfbV Photorhabdus temperata
Q7N2I2 2.06e-77 229 73 0 146 3 plu3094 UPF0208 membrane protein plu3094 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GH23 1.2e-72 217 72 0 140 3 Spro_3315 UPF0208 membrane protein Spro_3315 Serratia proteamaculans (strain 568)
A1JLD6 5.88e-72 215 72 0 140 3 YE1335 UPF0208 membrane protein YE1335 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2K829 1.83e-70 211 71 0 140 3 YPTS_2690 UPF0208 membrane protein YPTS_2690 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q668Z2 1.83e-70 211 71 0 140 3 YPTB2595 UPF0208 membrane protein YPTB2595 Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JGK5 1.83e-70 211 71 0 140 3 YPK_1552 UPF0208 membrane protein YPK_1552 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FGP5 1.83e-70 211 71 0 140 3 YpsIP31758_1444 UPF0208 membrane protein YpsIP31758_1444 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7MH29 3.87e-70 211 67 1 150 3 ESA_00924 UPF0208 membrane protein ESA_00924 Cronobacter sakazakii (strain ATCC BAA-894)
Q8ZND7 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TQ70 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella schwarzengrund (strain CVM19633)
B5BCL0 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella paratyphi A (strain AKU_12601)
C0Q030 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella paratyphi C (strain RKS4594)
A9N4B4 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PN46 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZ08 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella newport (strain SL254)
B4TBK3 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella heidelberg (strain SL476)
B5RCG1 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R317 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella enteritidis PT4 (strain P125109)
B5FPH7 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella dublin (strain CT_02021853)
Q57M19 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella choleraesuis (strain SC-B67)
B5EZL8 3.91e-70 211 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella agona (strain SL483)
Q8Z521 7.22e-70 210 68 1 150 3 yfbV UPF0208 membrane protein YfbV Salmonella typhi
Q8ZDJ8 8.89e-70 210 71 0 140 3 YPO2564 UPF0208 membrane protein YPO2564/y1623/YP_2375 Yersinia pestis
Q1CHP4 8.89e-70 210 71 0 140 3 YPN_2157 UPF0208 membrane protein YPN_2157 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C6A2 8.89e-70 210 71 0 140 3 YPA_2054 UPF0208 membrane protein YPA_2054 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TM43 8.89e-70 210 71 0 140 3 YPDSF_1972 UPF0208 membrane protein YPDSF_1972 Yersinia pestis (strain Pestoides F)
A9R6M8 8.89e-70 210 71 0 140 3 YpAngola_A1824 UPF0208 membrane protein YpAngola_A1824 Yersinia pestis bv. Antiqua (strain Angola)
A8ADU3 9.09e-70 210 66 1 150 3 CKO_00500 UPF0208 membrane protein CKO_00500 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3YZR6 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Shigella sonnei (strain Ss046)
Q32DP4 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Shigella dysenteriae serotype 1 (strain Sd197)
Q31YG5 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Shigella boydii serotype 4 (strain Sb227)
B2TW76 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LLP9 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain SMS-3-5 / SECEC)
B6I7L7 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain SE11)
B7N5Q7 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8D9 2.38e-69 209 66 1 150 1 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain K12)
B1IXP7 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TFF1 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A2G3 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O9:H4 (strain HS)
B1X906 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain K12 / DH10B)
C4ZVI8 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5X4 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O8 (strain IAI1)
B7MXH4 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O81 (strain ED1a)
B7NNX4 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXT5 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8E0 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O157:H7
B7LBE9 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain 55989 / EAEC)
B7UFV3 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPA9 2.38e-69 209 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83KB1 3.61e-69 208 66 1 150 3 yfbV UPF0208 membrane protein YfbV Shigella flexneri
Q0T2J2 3.61e-69 208 66 1 150 3 yfbV UPF0208 membrane protein YfbV Shigella flexneri serotype 5b (strain 8401)
A4WCS4 9.9e-69 207 67 1 150 3 Ent638_2839 UPF0208 membrane protein Ent638_2839 Enterobacter sp. (strain 638)
C6DA53 1.48e-68 207 71 0 137 3 PC1_2779 UPF0208 membrane protein PC1_2779 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q1R9C0 2.35e-68 206 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli (strain UTI89 / UPEC)
A1ADE4 2.35e-68 206 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O1:K1 / APEC
B7MG59 2.35e-68 206 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LM37 2.99e-68 206 65 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8FFJ2 4.25e-68 206 66 1 150 3 yfbV UPF0208 membrane protein YfbV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6D2Q7 6.73e-68 205 70 0 137 3 ECA3038 UPF0208 membrane protein ECA3038 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TBY2 1.79e-67 204 64 1 150 3 KPN78578_26420 UPF0208 membrane protein KPN78578_26420 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNU5 1.79e-67 204 64 1 150 3 KPK_1462 UPF0208 membrane protein KPK_1462 Klebsiella pneumoniae (strain 342)
C5B8J9 6.7e-66 200 65 0 140 3 NT01EI_2692 UPF0208 membrane protein NT01EI_2692 Edwardsiella ictaluri (strain 93-146)
Q2NSJ5 8.14e-65 197 64 0 140 3 SG1605 UPF0208 membrane protein SG1605 Sodalis glossinidius (strain morsitans)
Q8DAH7 4.46e-42 140 46 1 144 3 VV1_2222 UPF0208 membrane protein VV1_2222 Vibrio vulnificus (strain CMCP6)
Q7MJM9 4.46e-42 140 46 1 144 3 VV2132 UPF0208 membrane protein VV2132 Vibrio vulnificus (strain YJ016)
Q9KT06 1.86e-41 138 45 1 144 3 VC_1099 UPF0208 membrane protein VC_1099 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87MZ5 2.22e-41 138 46 1 144 3 VP2081 UPF0208 membrane protein VP2081 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MVD8 1.61e-40 135 45 1 142 3 VIBHAR_02941 UPF0208 membrane protein VIBHAR_02941 Vibrio campbellii (strain ATCC BAA-1116)
B7VLV8 2.82e-40 135 43 1 144 3 VS_0999 UPF0208 membrane protein VS_0999 Vibrio atlanticus (strain LGP32)
Q6LNF7 7.21e-40 134 49 1 134 3 PBPRA2797 UPF0208 membrane protein PBPRA2797 Photobacterium profundum (strain SS9)
B5FC41 8.49e-40 134 47 2 141 3 VFMJ11_0876 UPF0208 membrane protein VFMJ11_0876 Aliivibrio fischeri (strain MJ11)
Q5E6L3 8.49e-40 134 47 2 141 3 VF_0838 UPF0208 membrane protein VF_0838 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EI58 8.29e-39 131 43 2 151 3 VSAL_I2111 UPF0208 membrane protein VSAL_I2111 Aliivibrio salmonicida (strain LFI1238)
Q9CMV2 8.1e-33 116 41 1 145 3 PM0703 UPF0208 membrane protein PM0703 Pasteurella multocida (strain Pm70)
P44127 5.49e-30 108 38 1 146 3 HI_1205 UPF0208 membrane protein HI_1205 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UCQ5 3.19e-29 107 36 1 146 3 CGSHiEE_06015 UPF0208 membrane protein CGSHiEE_06015 Haemophilus influenzae (strain PittEE)
Q4QL94 3.19e-29 107 36 1 146 3 NTHI1376 UPF0208 membrane protein NTHI1376 Haemophilus influenzae (strain 86-028NP)
Q8ED56 2.48e-28 104 42 2 144 3 SO_2914 UPF0208 membrane protein SO_2914 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VKY8 1.82e-26 100 36 2 145 3 HD_1715 UPF0208 membrane protein HD_1715 Haemophilus ducreyi (strain 35000HP / ATCC 700724)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_05860
Feature type CDS
Gene yfbV
Product terminus macrodomain insulation protein YfbV
Location 177436 - 177891 (strand: -1)
Length 456 (nucleotides) / 151 (amino acids)
In genomic island -

Contig

Accession ZDB_362
Length 257361 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1942
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04217 Protein of unknown function, DUF412

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3092 Function unknown (S) S Uncharacterized membrane protein YfbV, UPF0208 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09899 uncharacterized protein - -

Protein Sequence

MPDNTPAKPGLFRALRLGKRYAATWPAVKQLAPVFPENRVIKSTQFGIRFMPPLSVFTLTWQIALGGALGPAVATALFACSLPLQGLWWLGRRAATPLPAGLLSWFYEIRAKFAEAGIAIAPVEGTPDYMALAELLKRAFKQLDNSFLDDL

Flanking regions ( +/- flanking 50bp)

TGAATGTAGCCATATTTTAATTATTATGTTTTTTATTGATTGAGGTCATAATGCCTGATAACACACCGGCAAAACCGGGTCTGTTCCGCGCACTGCGTCTCGGTAAACGTTACGCCGCCACCTGGCCGGCCGTGAAACAGCTCGCCCCGGTTTTCCCGGAGAATCGTGTCATAAAATCGACACAGTTCGGTATCCGTTTTATGCCGCCGCTGTCGGTGTTTACCCTGACATGGCAGATAGCCCTCGGCGGGGCATTAGGTCCCGCAGTCGCCACCGCACTGTTTGCCTGTTCGCTGCCGCTGCAGGGGCTGTGGTGGCTGGGACGGCGCGCCGCCACGCCTTTACCGGCCGGGCTGCTCAGCTGGTTTTATGAAATCCGTGCAAAATTTGCCGAAGCCGGGATTGCGATTGCACCGGTTGAGGGCACACCGGATTATATGGCACTGGCCGAGTTACTGAAACGCGCTTTTAAGCAGCTGGATAACTCTTTTCTGGATGACCTGTAAGTACGGCTGTTTTCCGCCCGGTGCTGCGGGCGGAAGAATCCCTTCCTTTA