Homologs in group_1903

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14195 FBDBKF_14195 77.4 Morganella morganii S1 yfbU YfbU family protein
EHELCC_08085 EHELCC_08085 77.4 Morganella morganii S2 yfbU YfbU family protein
NLDBIP_08410 NLDBIP_08410 77.4 Morganella morganii S4 yfbU YfbU family protein
LHKJJB_05855 LHKJJB_05855 77.4 Morganella morganii S3 yfbU YfbU family protein
HKOGLL_05060 HKOGLL_05060 77.4 Morganella morganii S5 yfbU YfbU family protein
F4V73_RS02735 F4V73_RS02735 76.8 Morganella psychrotolerans - YfbU family protein

Distribution of the homologs in the orthogroup group_1903

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1903

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JLD8 2.08e-103 296 82 0 164 3 YE1336 UPF0304 protein YE1336 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2K828 2.23e-102 293 81 0 164 3 YPTS_2689 UPF0304 protein YPTS_2689 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q668Z3 2.23e-102 293 81 0 164 3 YPTB2594 UPF0304 protein YPTB2594 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZDJ9 2.23e-102 293 81 0 164 3 YPO2563 UPF0304 protein YPO2563/y1624/YP_2374 Yersinia pestis
Q1CHP5 2.23e-102 293 81 0 164 3 YPN_2156 UPF0304 protein YPN_2156 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C6A3 2.23e-102 293 81 0 164 3 YPA_2053 UPF0304 protein YPA_2053 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TM42 2.23e-102 293 81 0 164 3 YPDSF_1971 UPF0304 protein YPDSF_1971 Yersinia pestis (strain Pestoides F)
A9R6M7 2.23e-102 293 81 0 164 3 YpAngola_A1823 UPF0304 protein YpAngola_A1823 Yersinia pestis bv. Antiqua (strain Angola)
B1JGK6 2.23e-102 293 81 0 164 3 YPK_1553 UPF0304 protein YPK_1553 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FGP6 2.23e-102 293 81 0 164 3 YpsIP31758_1445 UPF0304 protein YpsIP31758_1445 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4WCS3 2.74e-101 290 81 0 164 3 Ent638_2838 UPF0304 protein Ent638_2838 Enterobacter sp. (strain 638)
A7MH30 1.26e-100 289 79 0 164 3 ESA_00925 UPF0304 protein ESA_00925 Cronobacter sakazakii (strain ATCC BAA-894)
B5XNU6 1.68e-98 283 79 0 164 3 KPK_1463 UPF0304 protein KPK_1463 Klebsiella pneumoniae (strain 342)
Q57M20 1.76e-98 283 79 0 164 3 yfbU UPF0304 protein YfbU Salmonella choleraesuis (strain SC-B67)
P60817 1.77e-98 283 79 0 164 3 yfbU UPF0304 protein YfbU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60816 1.77e-98 283 79 0 164 3 yfbU UPF0304 protein YfbU Salmonella typhi
B5BCL1 1.77e-98 283 79 0 164 3 yfbU UPF0304 protein YfbU Salmonella paratyphi A (strain AKU_12601)
Q5PN45 1.77e-98 283 79 0 164 3 yfbU UPF0304 protein YfbU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RCG0 1.77e-98 283 79 0 164 3 yfbU UPF0304 protein YfbU Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R316 1.77e-98 283 79 0 164 3 yfbU UPF0304 protein YfbU Salmonella enteritidis PT4 (strain P125109)
A8ADU4 2.49e-98 283 79 0 164 3 CKO_00501 UPF0304 protein CKO_00501 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C5B8J8 9e-98 281 79 0 164 3 NT01EI_2691 UPF0304 protein NT01EI_2691 Edwardsiella ictaluri (strain 93-146)
B2TW75 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LLP8 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli (strain SMS-3-5 / SECEC)
B6I7L6 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli (strain SE11)
B7N5Q6 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8W8 1.76e-97 281 79 0 164 1 yfbU UPF0304 protein YfbU Escherichia coli (strain K12)
B1IXP8 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8W9 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFF2 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1X905 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli (strain K12 / DH10B)
C4ZVI7 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5X3 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O8 (strain IAI1)
B7MXH3 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O81 (strain ED1a)
B7NNX3 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXT4 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCV1 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O157:H7
B7LBE8 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli (strain 55989 / EAEC)
B7MG58 1.76e-97 281 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFV2 3.74e-97 280 79 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q83QS1 1.84e-96 278 78 0 164 3 yfbU UPF0304 protein YfbU Shigella flexneri
Q0T2J3 5.04e-96 277 78 0 164 3 yfbU UPF0304 protein YfbU Shigella flexneri serotype 5b (strain 8401)
A7ZPA8 5.56e-96 277 78 0 164 3 yfbU UPF0304 protein YfbU Escherichia coli O139:H28 (strain E24377A / ETEC)
C6DA52 6.07e-96 277 77 0 164 3 PC1_2778 UPF0304 protein PC1_2778 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D2Q8 8.16e-96 277 76 0 164 3 ECA3037 UPF0304 protein ECA3037 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7MJ16 4.62e-69 209 57 1 166 3 VV2347 UPF0304 protein VV2347 Vibrio vulnificus (strain YJ016)
Q8DAU5 4.62e-69 209 57 1 166 3 VV1_2093 UPF0304 protein VV1_2093 Vibrio vulnificus (strain CMCP6)
B6EIJ8 1e-68 208 59 2 167 3 VSAL_I2183 UPF0304 protein VSAL_I2183 Aliivibrio salmonicida (strain LFI1238)
Q5E3V7 5.7e-67 204 58 2 167 3 VF_1794 UPF0304 protein VF_1794 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FG97 6.65e-67 204 58 2 167 3 VFMJ11_1926 UPF0304 protein VFMJ11_1926 Aliivibrio fischeri (strain MJ11)
Q9KQX6 1.04e-66 203 57 1 166 3 VC_1871 UPF0304 protein VC_1871 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87R08 1.48e-66 203 57 1 166 3 VP0990 UPF0304 protein VP0990 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VM08 4.04e-66 202 56 1 166 3 VS_1049 UPF0304 protein VS_1049 Vibrio atlanticus (strain LGP32)
Q6LNI6 6.62e-66 201 59 1 166 3 PBPRA2768 UPF0304 protein PBPRA2768 Photobacterium profundum (strain SS9)
A7MZN5 7.22e-66 201 56 1 166 3 VIBHAR_01542 UPF0304 protein VIBHAR_01542 Vibrio campbellii (strain ATCC BAA-1116)
Q65QB3 3.92e-64 196 54 0 164 3 MS2240 UPF0304 protein MS2240 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UWD5 1.01e-61 191 50 0 164 3 HSM_1818 UPF0304 protein HSM_1818 Histophilus somni (strain 2336)
Q9CKV5 4.63e-60 186 50 0 164 3 PM1500 UPF0304 protein PM1500 Pasteurella multocida (strain Pm70)
A6VLS1 2.56e-58 182 50 0 164 3 Asuc_0543 UPF0304 protein Asuc_0543 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q60310 5.5e-21 87 29 5 169 3 MJECS11 UPF0304 protein MJECS11 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08675
Feature type CDS
Gene -
Product YfbU family protein
Location 1895831 - 1896325 (strand: -1)
Length 495 (nucleotides) / 164 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1903
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03887 YfbU domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3013 Function unknown (S) S Uncharacterized conserved protein YfbU, UPF0304 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09161 uncharacterized protein - -

Protein Sequence

MEMTHAQRLILSNQYKMMTMMDPDNAERYRRYQTIIERGYGLQLRELDRDFDEMSEETCRTIINIMEMYHALQVSRENLKSPEMPDARRVAFMGFDAATESRYLSYVRFMVNTEGRYTHFDSGSHGFNSQTPMWEKYQRMLAVWLACPRQYHLSSVEIQQILNA

Flanking regions ( +/- flanking 50bp)

GTTTTGATTAATGCCATGCTCTCTCCAATAATTTCTTTGGAGAATTAATGATGGAAATGACACACGCACAACGCTTGATCCTCTCTAATCAATATAAAATGATGACCATGATGGATCCTGATAACGCTGAACGTTATCGTCGCTATCAGACAATTATTGAACGTGGTTATGGATTACAATTACGTGAATTAGACCGCGATTTTGATGAGATGTCAGAAGAGACCTGCCGAACCATTATTAACATCATGGAAATGTACCATGCATTGCAAGTTTCTCGAGAAAATTTAAAATCACCAGAAATGCCGGATGCTCGTCGAGTGGCATTTATGGGCTTTGATGCAGCAACAGAATCTCGTTATCTTAGCTATGTACGCTTTATGGTCAATACTGAAGGGCGATATACGCATTTTGATAGTGGTAGTCATGGTTTTAACTCTCAAACTCCTATGTGGGAGAAATACCAAAGAATGCTGGCTGTTTGGTTAGCCTGTCCACGTCAATATCACCTAAGCAGTGTTGAGATCCAACAAATACTGAATGCGTAATTATTAACGCATCACGATAAGGTAGGCATAAAATATGACAATCACCTGTA